eF-site ID 3jt7-AB PDB Code 3jt7 Chain A, B click to enlarge Title Structure of neuronal nitric oxide synthase heme domain complexed with N~5~-[2-(propylsulfanyl)ethanimidoyl]-L-ornithine Classification OXIDOREDUCTASE Compound Nitric oxide synthase, brain Source (NOS1_RAT) Sequence A:  RFLKVKNWETDVVLTDTLHLKSTLETGCTEHICMGSIMLP TKDQLFPLAKEFLDQYYSSIKRFGSKAHMDRLEEVNKEIE STSTYQLKDTELIYGAKHAWRNASRCVGRIQWSKLQVFDA RDCTTAHGMFNYICNHVKYATNKGNLRSAITIFPQRTDGK HDFRVWNSQLIRYAGYKQPDGSTLGDPANVQFTEICIQQG WKAPRGRFDVLPLLLQANGNDPELFQIPPELVLEVPIRHP KFDWFKDLGLKWYGLPAVSNMLLEIGGLEFSACPFSGWYM GTEIGVRDYCDNSRYNILEEVAKKMDLDMRKTSSLWKDQA LVEINIAVLYSFQSDKVTIVDHHSATESFIKHMENEYRCR GGCPADWVWIVPPMSGSITPVFHQEMLNYRLTPSFEYQPD PWNTHVW B:  RFLKVKNWETDVVLTDTLHLKSTLETGCTEHICMGSIMLP VRTKDQLFPLAKEFLDQYYSSIKRFGSKAHMDRLEEVNKE IESTSTYQLKDTELIYGAKHAWRNASRCVGRIQWSKLQVF DARDCTTAHGMFNYICNHVKYATNKGNLRSAITIFPQRTD GKHDFRVWNSQLIRYAGYKQPDGSTLGDPANVQFTEICIQ QGWKAPRGRFDVLPLLLQANGNDPELFQIPPELVLEVPIR HPKFDWFKDLGLKWYGLPAVSNMLLEIGGLEFSACPFSGW YMGTEIGVRDYCDNSRYNILEEVAKKMDLDMRKTSSLWKD QALVEINIAVLYSFQSDKVTIVDHHSATESFIKHMENEYR CRGGCPADWVWIVPPMSGSITPVFHQEMLNYRLTPSFEYQ PDPWNTHVWKG Description Functional site 1) chain A residue 409 type sequence W description BINDING SITE FOR RESIDUE HEM A 750 source : AC1 2) chain A residue 415 type sequence C description BINDING SITE FOR RESIDUE HEM A 750 source : AC1 3) chain A residue 416 type sequence V description BINDING SITE FOR RESIDUE HEM A 750 source : AC1 4) chain A residue 457 type sequence S description BINDING SITE FOR RESIDUE HEM A 750 source : AC1 5) chain A residue 584 type sequence F description BINDING SITE FOR RESIDUE HEM A 750 source : AC1 6) chain A residue 585 type sequence S description BINDING SITE FOR RESIDUE HEM A 750 source : AC1 7) chain A residue 587 type sequence W description BINDING SITE FOR RESIDUE HEM A 750 source : AC1 8) chain A residue 592 type sequence E description BINDING SITE FOR RESIDUE HEM A 750 source : AC1 9) chain A residue 678 type sequence W description BINDING SITE FOR RESIDUE HEM A 750 source : AC1 10) chain A residue 704 type sequence F description BINDING SITE FOR RESIDUE HEM A 750 source : AC1 11) chain A residue 706 type sequence Y description BINDING SITE FOR RESIDUE HEM A 750 source : AC1 12) chain A residue 334 type sequence S description BINDING SITE FOR RESIDUE H4B A 760 source : AC2 13) chain A residue 596 type sequence R description BINDING SITE FOR RESIDUE H4B A 760 source : AC2 14) chain A residue 677 type sequence V description BINDING SITE FOR RESIDUE H4B A 760 source : AC2 15) chain A residue 678 type sequence W description BINDING SITE FOR RESIDUE H4B A 760 source : AC2 16) chain B residue 676 type sequence W description BINDING SITE FOR RESIDUE H4B A 760 source : AC2 17) chain B residue 691 type sequence F description BINDING SITE FOR RESIDUE H4B A 760 source : AC2 18) chain B residue 692 type sequence H description BINDING SITE FOR RESIDUE H4B A 760 source : AC2 19) chain B residue 693 type sequence Q description BINDING SITE FOR RESIDUE H4B A 760 source : AC2 20) chain B residue 694 type sequence E description BINDING SITE FOR RESIDUE H4B A 760 source : AC2 21) chain A residue 478 type sequence Q description BINDING SITE FOR RESIDUE JM5 A 800 source : AC3 22) chain A residue 562 type sequence Y description BINDING SITE FOR RESIDUE JM5 A 800 source : AC3 23) chain A residue 565 type sequence P description BINDING SITE FOR RESIDUE JM5 A 800 source : AC3 24) chain A residue 566 type sequence A description BINDING SITE FOR RESIDUE JM5 A 800 source : AC3 25) chain A residue 567 type sequence V description BINDING SITE FOR RESIDUE JM5 A 800 source : AC3 26) chain A residue 584 type sequence F description BINDING SITE FOR RESIDUE JM5 A 800 source : AC3 27) chain A residue 585 type sequence S description BINDING SITE FOR RESIDUE JM5 A 800 source : AC3 28) chain A residue 586 type sequence G description BINDING SITE FOR RESIDUE JM5 A 800 source : AC3 29) chain A residue 587 type sequence W description BINDING SITE FOR RESIDUE JM5 A 800 source : AC3 30) chain A residue 588 type sequence Y description BINDING SITE FOR RESIDUE JM5 A 800 source : AC3 31) chain A residue 592 type sequence E description BINDING SITE FOR RESIDUE JM5 A 800 source : AC3 32) chain A residue 597 type sequence D description BINDING SITE FOR RESIDUE JM5 A 800 source : AC3 33) chain A residue 587 type sequence W description BINDING SITE FOR RESIDUE ACT A 860 source : AC4 34) chain A residue 649 type sequence V description BINDING SITE FOR RESIDUE ACT A 860 source : AC4 35) chain A residue 657 type sequence S description BINDING SITE FOR RESIDUE ACT A 860 source : AC4 36) chain A residue 326 type sequence C description BINDING SITE FOR RESIDUE ZN A 900 source : AC5 37) chain A residue 331 type sequence C description BINDING SITE FOR RESIDUE ZN A 900 source : AC5 38) chain B residue 326 type sequence C description BINDING SITE FOR RESIDUE ZN A 900 source : AC5 39) chain B residue 331 type sequence C description BINDING SITE FOR RESIDUE ZN A 900 source : AC5 40) chain B residue 409 type sequence W description BINDING SITE FOR RESIDUE HEM B 750 source : AC6 41) chain B residue 415 type sequence C description BINDING SITE FOR RESIDUE HEM B 750 source : AC6 42) chain B residue 457 type sequence S description BINDING SITE FOR RESIDUE HEM B 750 source : AC6 43) chain B residue 584 type sequence F description BINDING SITE FOR RESIDUE HEM B 750 source : AC6 44) chain B residue 585 type sequence S description BINDING SITE FOR RESIDUE HEM B 750 source : AC6 45) chain B residue 587 type sequence W description BINDING SITE FOR RESIDUE HEM B 750 source : AC6 46) chain B residue 592 type sequence E description BINDING SITE FOR RESIDUE HEM B 750 source : AC6 47) chain B residue 678 type sequence W description BINDING SITE FOR RESIDUE HEM B 750 source : AC6 48) chain B residue 704 type sequence F description BINDING SITE FOR RESIDUE HEM B 750 source : AC6 49) chain B residue 706 type sequence Y description BINDING SITE FOR RESIDUE HEM B 750 source : AC6 50) chain A residue 676 type sequence W description BINDING SITE FOR RESIDUE H4B B 760 source : AC7 51) chain A residue 691 type sequence F description BINDING SITE FOR RESIDUE H4B B 760 source : AC7 52) chain A residue 692 type sequence H description BINDING SITE FOR RESIDUE H4B B 760 source : AC7 53) chain A residue 693 type sequence Q description BINDING SITE FOR RESIDUE H4B B 760 source : AC7 54) chain A residue 694 type sequence E description BINDING SITE FOR RESIDUE H4B B 760 source : AC7 55) chain B residue 334 type sequence S description BINDING SITE FOR RESIDUE H4B B 760 source : AC7 56) chain B residue 596 type sequence R description BINDING SITE FOR RESIDUE H4B B 760 source : AC7 57) chain B residue 677 type sequence V description BINDING SITE FOR RESIDUE H4B B 760 source : AC7 58) chain B residue 678 type sequence W description BINDING SITE FOR RESIDUE H4B B 760 source : AC7 59) chain B residue 478 type sequence Q description BINDING SITE FOR RESIDUE JM5 B 800 source : AC8 60) chain B residue 562 type sequence Y description BINDING SITE FOR RESIDUE JM5 B 800 source : AC8 61) chain B residue 565 type sequence P description BINDING SITE FOR RESIDUE JM5 B 800 source : AC8 62) chain B residue 567 type sequence V description BINDING SITE FOR RESIDUE JM5 B 800 source : AC8 63) chain B residue 584 type sequence F description BINDING SITE FOR RESIDUE JM5 B 800 source : AC8 64) chain B residue 586 type sequence G description BINDING SITE FOR RESIDUE JM5 B 800 source : AC8 65) chain B residue 587 type sequence W description BINDING SITE FOR RESIDUE JM5 B 800 source : AC8 66) chain B residue 588 type sequence Y description BINDING SITE FOR RESIDUE JM5 B 800 source : AC8 67) chain B residue 592 type sequence E description BINDING SITE FOR RESIDUE JM5 B 800 source : AC8 68) chain B residue 597 type sequence D description BINDING SITE FOR RESIDUE JM5 B 800 source : AC8 69) chain B residue 587 type sequence W description BINDING SITE FOR RESIDUE ACT B 860 source : AC9 70) chain B residue 649 type sequence V description BINDING SITE FOR RESIDUE ACT B 860 source : AC9 71) chain A residue 414-421 type prosite sequence RCVGRIQW description NOS Nitric oxide synthase (NOS) signature. RCVGRIqW source prosite : PS60001 72) chain A residue 334 type BINDING sequence S description BINDING => ECO:0000250|UniProtKB:P29475 source Swiss-Prot : SWS_FT_FI1 73) chain B residue 334 type BINDING sequence S description BINDING => ECO:0000250|UniProtKB:P29475 source Swiss-Prot : SWS_FT_FI1 74) chain B residue 478 type BINDING sequence Q description BINDING => ECO:0000250|UniProtKB:P29475 source Swiss-Prot : SWS_FT_FI1 75) chain B residue 587 type BINDING sequence W description BINDING => ECO:0000250|UniProtKB:P29475 source Swiss-Prot : SWS_FT_FI1 76) chain B residue 588 type BINDING sequence Y description BINDING => ECO:0000250|UniProtKB:P29475 source Swiss-Prot : SWS_FT_FI1 77) chain B residue 592 type BINDING sequence E description BINDING => ECO:0000250|UniProtKB:P29475 source Swiss-Prot : SWS_FT_FI1 78) chain B residue 677 type BINDING sequence V description BINDING => ECO:0000250|UniProtKB:P29475 source Swiss-Prot : SWS_FT_FI1 79) chain B residue 678 type BINDING sequence W description BINDING => ECO:0000250|UniProtKB:P29475 source Swiss-Prot : SWS_FT_FI1 80) chain B residue 691 type BINDING sequence F description BINDING => ECO:0000250|UniProtKB:P29475 source Swiss-Prot : SWS_FT_FI1 81) chain B residue 706 type BINDING sequence Y description BINDING => ECO:0000250|UniProtKB:P29475 source Swiss-Prot : SWS_FT_FI1 82) chain A residue 478 type BINDING sequence Q description BINDING => ECO:0000250|UniProtKB:P29475 source Swiss-Prot : SWS_FT_FI1 83) chain A residue 587 type BINDING sequence W description BINDING => ECO:0000250|UniProtKB:P29475 source Swiss-Prot : SWS_FT_FI1 84) chain A residue 588 type BINDING sequence Y description BINDING => ECO:0000250|UniProtKB:P29475 source Swiss-Prot : SWS_FT_FI1 85) chain A residue 592 type BINDING sequence E description BINDING => ECO:0000250|UniProtKB:P29475 source Swiss-Prot : SWS_FT_FI1 86) chain A residue 677 type BINDING sequence V description BINDING => ECO:0000250|UniProtKB:P29475 source Swiss-Prot : SWS_FT_FI1 87) chain A residue 678 type BINDING sequence W description BINDING => ECO:0000250|UniProtKB:P29475 source Swiss-Prot : SWS_FT_FI1 88) chain A residue 691 type BINDING sequence F description BINDING => ECO:0000250|UniProtKB:P29475 source Swiss-Prot : SWS_FT_FI1 89) chain A residue 706 type BINDING sequence Y description BINDING => ECO:0000250|UniProtKB:P29475 source Swiss-Prot : SWS_FT_FI1 90) chain A residue 415 type BINDING sequence C description axial binding residue => ECO:0000250|UniProtKB:P29475 source Swiss-Prot : SWS_FT_FI2 91) chain B residue 415 type BINDING sequence C description axial binding residue => ECO:0000250|UniProtKB:P29475 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links