eF-site ID 3jrs-ABC PDB Code 3jrs Chain A, B, C click to enlarge Title Crystal structure of (+)-ABA-bound PYL1 Classification Hormone Receptor Compound Putative uncharacterized protein At5g46790 Source Arabidopsis thaliana (Mouse-ear cress) (Q8VZS8_ARATH) Sequence A:  DLTQDEFTQLSQSIAEFHTYQLGNGRCSSLLAQRIHAPPE TVWSVVRRFDRPQIYKHFIKSCNVSEDFEMRVGCTRDVNV ISGLPANTSRERLDLLDDDRRVTGFSITGGEHRLRNYKSV TTVHRFEKRIWTVVLESYVVDVPEGNSEEDTRLFADTVIR LNLQKLASITEAMN B:  SDLTQDEFTQLSQSIAEFHTYQLGNGRCSSLLAQRIHAPP ETVWSVVRRFDRPQIYKHFIKSCNVSEDFEMRVGCTRDVN VISGLPANTSRERLDLLDDDRRVTGFSITGGEHRLRNYKS VTTVHRFEIWTVVLESYVVDVPEGNSEEDTRLFADTVIRL NLQKLASITEAMN C:  TQLSQSIAEFHTYQGRCSSLLAQRIHAPPETVWSVVRRFD RPQIYKHFIKSCNVSEDFEMRVGCTRDVNVISGLPANTSR ERLDLLDDDRRVTGFSITHRLRNYKSVTTVHRFERIWTVV LESYVVDVPEGNSEEDTRLFADTVIRLNLQKLASITEAMN Description Functional site 1) chain A residue 86 type sequence K description BINDING SITE FOR RESIDUE A8S A 1 source : AC1 2) chain A residue 88 type sequence F description BINDING SITE FOR RESIDUE A8S A 1 source : AC1 3) chain A residue 110 type sequence V description BINDING SITE FOR RESIDUE A8S A 1 source : AC1 4) chain A residue 116 type sequence A description BINDING SITE FOR RESIDUE A8S A 1 source : AC1 5) chain A residue 135 type sequence F description BINDING SITE FOR RESIDUE A8S A 1 source : AC1 6) chain A residue 189 type sequence F description BINDING SITE FOR RESIDUE A8S A 1 source : AC1 7) chain B residue 86 type sequence K description BINDING SITE FOR RESIDUE A8S B 2 source : AC2 8) chain B residue 110 type sequence V description BINDING SITE FOR RESIDUE A8S B 2 source : AC2 9) chain B residue 116 type sequence A description BINDING SITE FOR RESIDUE A8S B 2 source : AC2 10) chain B residue 119 type sequence S description BINDING SITE FOR RESIDUE A8S B 2 source : AC2 11) chain B residue 135 type sequence F description BINDING SITE FOR RESIDUE A8S B 2 source : AC2 12) chain B residue 137 type sequence I description BINDING SITE FOR RESIDUE A8S B 2 source : AC2 13) chain B residue 147 type sequence Y description BINDING SITE FOR RESIDUE A8S B 2 source : AC2 14) chain B residue 189 type sequence F description BINDING SITE FOR RESIDUE A8S B 2 source : AC2 15) chain B residue 197 type sequence N description BINDING SITE FOR RESIDUE A8S B 2 source : AC2 16) chain C residue 86 type sequence K description BINDING SITE FOR RESIDUE A8S C 3 source : AC3 17) chain C residue 115 type sequence P description BINDING SITE FOR RESIDUE A8S C 3 source : AC3 18) chain C residue 116 type sequence A description BINDING SITE FOR RESIDUE A8S C 3 source : AC3 19) chain C residue 119 type sequence S description BINDING SITE FOR RESIDUE A8S C 3 source : AC3 20) chain C residue 135 type sequence F description BINDING SITE FOR RESIDUE A8S C 3 source : AC3 21) chain C residue 197 type sequence N description BINDING SITE FOR RESIDUE A8S C 3 source : AC3 22) chain A residue 182 type SITE sequence S description Involved in interactions with PP2Cs => ECO:0000250|UniProtKB:O49686 source Swiss-Prot : SWS_FT_FI3 23) chain B residue 182 type SITE sequence S description Involved in interactions with PP2Cs => ECO:0000250|UniProtKB:O49686 source Swiss-Prot : SWS_FT_FI3 24) chain C residue 182 type SITE sequence S description Involved in interactions with PP2Cs => ECO:0000250|UniProtKB:O49686 source Swiss-Prot : SWS_FT_FI3 25) chain C residue 116 type BINDING sequence A description BINDING => ECO:0000269|PubMed:19855379, ECO:0000269|PubMed:19893533 source Swiss-Prot : SWS_FT_FI1 26) chain C residue 143 type BINDING sequence R description BINDING => ECO:0000269|PubMed:19855379, ECO:0000269|PubMed:19893533 source Swiss-Prot : SWS_FT_FI1 27) chain C residue 171 type BINDING sequence E description BINDING => ECO:0000269|PubMed:19855379, ECO:0000269|PubMed:19893533 source Swiss-Prot : SWS_FT_FI1 28) chain B residue 143 type BINDING sequence R description BINDING => ECO:0000269|PubMed:19855379, ECO:0000269|PubMed:19893533 source Swiss-Prot : SWS_FT_FI1 29) chain B residue 171 type BINDING sequence E description BINDING => ECO:0000269|PubMed:19855379, ECO:0000269|PubMed:19893533 source Swiss-Prot : SWS_FT_FI1 30) chain C residue 86 type BINDING sequence K description BINDING => ECO:0000269|PubMed:19855379, ECO:0000269|PubMed:19893533 source Swiss-Prot : SWS_FT_FI1 31) chain A residue 86 type BINDING sequence K description BINDING => ECO:0000269|PubMed:19855379, ECO:0000269|PubMed:19893533 source Swiss-Prot : SWS_FT_FI1 32) chain A residue 116 type BINDING sequence A description BINDING => ECO:0000269|PubMed:19855379, ECO:0000269|PubMed:19893533 source Swiss-Prot : SWS_FT_FI1 33) chain A residue 143 type BINDING sequence R description BINDING => ECO:0000269|PubMed:19855379, ECO:0000269|PubMed:19893533 source Swiss-Prot : SWS_FT_FI1 34) chain A residue 171 type BINDING sequence E description BINDING => ECO:0000269|PubMed:19855379, ECO:0000269|PubMed:19893533 source Swiss-Prot : SWS_FT_FI1 35) chain B residue 86 type BINDING sequence K description BINDING => ECO:0000269|PubMed:19855379, ECO:0000269|PubMed:19893533 source Swiss-Prot : SWS_FT_FI1 36) chain B residue 116 type BINDING sequence A description BINDING => ECO:0000269|PubMed:19855379, ECO:0000269|PubMed:19893533 source Swiss-Prot : SWS_FT_FI1 37) chain A residue 115 type SITE sequence P description Involved in interactions with PP2Cs => ECO:0000269|PubMed:19855379 source Swiss-Prot : SWS_FT_FI2 38) chain B residue 115 type SITE sequence P description Involved in interactions with PP2Cs => ECO:0000269|PubMed:19855379 source Swiss-Prot : SWS_FT_FI2 39) chain C residue 115 type SITE sequence P description Involved in interactions with PP2Cs => ECO:0000269|PubMed:19855379 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links