eF-site ID 3jrs-A PDB Code 3jrs Chain A click to enlarge Title Crystal structure of (+)-ABA-bound PYL1 Classification Hormone Receptor Compound Putative uncharacterized protein At5g46790 Source Arabidopsis thaliana (Mouse-ear cress) (Q8VZS8_ARATH) Sequence A:  DLTQDEFTQLSQSIAEFHTYQLGNGRCSSLLAQRIHAPPE TVWSVVRRFDRPQIYKHFIKSCNVSEDFEMRVGCTRDVNV ISGLPANTSRERLDLLDDDRRVTGFSITGGEHRLRNYKSV TTVHRFEKRIWTVVLESYVVDVPEGNSEEDTRLFADTVIR LNLQKLASITEAMN Description Functional site 1) chain A residue 86 type sequence K description BINDING SITE FOR RESIDUE A8S A 1 source : AC1 2) chain A residue 88 type sequence F description BINDING SITE FOR RESIDUE A8S A 1 source : AC1 3) chain A residue 110 type sequence V description BINDING SITE FOR RESIDUE A8S A 1 source : AC1 4) chain A residue 116 type sequence A description BINDING SITE FOR RESIDUE A8S A 1 source : AC1 5) chain A residue 135 type sequence F description BINDING SITE FOR RESIDUE A8S A 1 source : AC1 6) chain A residue 189 type sequence F description BINDING SITE FOR RESIDUE A8S A 1 source : AC1 7) chain A residue 86 type BINDING sequence K description BINDING => ECO:0000269|PubMed:19855379, ECO:0000269|PubMed:19893533 source Swiss-Prot : SWS_FT_FI1 8) chain A residue 116 type BINDING sequence A description BINDING => ECO:0000269|PubMed:19855379, ECO:0000269|PubMed:19893533 source Swiss-Prot : SWS_FT_FI1 9) chain A residue 143 type BINDING sequence R description BINDING => ECO:0000269|PubMed:19855379, ECO:0000269|PubMed:19893533 source Swiss-Prot : SWS_FT_FI1 10) chain A residue 171 type BINDING sequence E description BINDING => ECO:0000269|PubMed:19855379, ECO:0000269|PubMed:19893533 source Swiss-Prot : SWS_FT_FI1 11) chain A residue 182 type SITE sequence S description Involved in interactions with PP2Cs => ECO:0000250|UniProtKB:O49686 source Swiss-Prot : SWS_FT_FI3 12) chain A residue 115 type SITE sequence P description Involved in interactions with PP2Cs => ECO:0000269|PubMed:19855379 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links