eF-site ID 3jrq-B
PDB Code 3jrq
Chain B

click to enlarge
Title Crystal structure of (+)-ABA-bound PYL1 in complex with ABI1
Classification HYDROLASE/Hormone Receptor
Compound Protein phosphatase 2C 56
Source Arabidopsis thaliana (Mouse-ear cress) (Q8VZS8_ARATH)
Sequence B:  LTQDEFTQLSQSIAEFHTYQLGNGRCSSLLAQRIHAPPET
VWSVVRRFDRPQIYKHFIKSCNVSEDFEMRVGCTRDVNVI
SGLPANTSRERLDLLDDDRRVTGFSITGGEHRLRNYKSVT
TVHRFERIWTVVLESYVVDVPEGNSEEDTRLFADTVIRLN
LQKLASITEAMNR
Description (1)  Protein phosphatase 2C 56 (E.C.3.1.3.16), Putative uncharacterized protein At5g46790


Functional site

1) chain B
residue 88
type
ligand
sequence F
description BINDING SITE FOR RESIDUE A8S B 1
source : AC1

2) chain B
residue 115
type
ligand
sequence P
description BINDING SITE FOR RESIDUE A8S B 1
source : AC1

3) chain B
residue 116
type
ligand
sequence A
description BINDING SITE FOR RESIDUE A8S B 1
source : AC1

4) chain B
residue 135
type
ligand
sequence F
description BINDING SITE FOR RESIDUE A8S B 1
source : AC1

5) chain B
residue 137
type
ligand
sequence I
description BINDING SITE FOR RESIDUE A8S B 1
source : AC1

6) chain B
residue 147
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE A8S B 1
source : AC1

7) chain B
residue 171
type
ligand
sequence E
description BINDING SITE FOR RESIDUE A8S B 1
source : AC1

8) chain B
residue 189
type
ligand
sequence F
description BINDING SITE FOR RESIDUE A8S B 1
source : AC1

9) chain B
residue 193
type
ligand
sequence V
description BINDING SITE FOR RESIDUE A8S B 1
source : AC1

10) chain B
residue 194
type
ligand
sequence I
description BINDING SITE FOR RESIDUE A8S B 1
source : AC1

11) chain B
residue 62
type BINDING
ligand
sequence A
description ABA.
source Swiss-Prot : SWS_FT_FI5

12) chain B
residue 147
type BINDING
ligand
sequence Y
description ABA.
source Swiss-Prot : SWS_FT_FI5

13) chain B
residue 91
type SITE
ligand
sequence S
description Involved in interactions with PP2Cs.
source Swiss-Prot : SWS_FT_FI6

14) chain B
residue 86
type binding
ligand A8S: (2Z,4E)-5-[(1S)-1-HYDROXY-2,6,6-TRIMETHYL-4-OXOCYCLOHEX-2-EN-1-YL]-3-METHYLPENTA-2,4-DIENOIC ACID
sequence K
description (2Z,4E)-5-[(1S)-1-HYDROXY-2,6,6-TRIMETHYL-4-OXOCYCLOHEX-2-EN-1-YL]-3-METHYLPENTA-2,4-DIENOIC ACID binding site
source pdb_hetatom : A8S_3jrq_B_1

15) chain B
residue 88
type binding
ligand A8S: (2Z,4E)-5-[(1S)-1-HYDROXY-2,6,6-TRIMETHYL-4-OXOCYCLOHEX-2-EN-1-YL]-3-METHYLPENTA-2,4-DIENOIC ACID
sequence F
description (2Z,4E)-5-[(1S)-1-HYDROXY-2,6,6-TRIMETHYL-4-OXOCYCLOHEX-2-EN-1-YL]-3-METHYLPENTA-2,4-DIENOIC ACID binding site
source pdb_hetatom : A8S_3jrq_B_1

16) chain B
residue 110
type binding
ligand A8S: (2Z,4E)-5-[(1S)-1-HYDROXY-2,6,6-TRIMETHYL-4-OXOCYCLOHEX-2-EN-1-YL]-3-METHYLPENTA-2,4-DIENOIC ACID
sequence V
description (2Z,4E)-5-[(1S)-1-HYDROXY-2,6,6-TRIMETHYL-4-OXOCYCLOHEX-2-EN-1-YL]-3-METHYLPENTA-2,4-DIENOIC ACID binding site
source pdb_hetatom : A8S_3jrq_B_1

17) chain B
residue 114-116
type binding
ligand A8S: (2Z,4E)-5-[(1S)-1-HYDROXY-2,6,6-TRIMETHYL-4-OXOCYCLOHEX-2-EN-1-YL]-3-METHYLPENTA-2,4-DIENOIC ACID
sequence LPA
description (2Z,4E)-5-[(1S)-1-HYDROXY-2,6,6-TRIMETHYL-4-OXOCYCLOHEX-2-EN-1-YL]-3-METHYLPENTA-2,4-DIENOIC ACID binding site
source pdb_hetatom : A8S_3jrq_B_1

18) chain B
residue 118-119
type binding
ligand A8S: (2Z,4E)-5-[(1S)-1-HYDROXY-2,6,6-TRIMETHYL-4-OXOCYCLOHEX-2-EN-1-YL]-3-METHYLPENTA-2,4-DIENOIC ACID
sequence TS
description (2Z,4E)-5-[(1S)-1-HYDROXY-2,6,6-TRIMETHYL-4-OXOCYCLOHEX-2-EN-1-YL]-3-METHYLPENTA-2,4-DIENOIC ACID binding site
source pdb_hetatom : A8S_3jrq_B_1

19) chain B
residue 121
type binding
ligand A8S: (2Z,4E)-5-[(1S)-1-HYDROXY-2,6,6-TRIMETHYL-4-OXOCYCLOHEX-2-EN-1-YL]-3-METHYLPENTA-2,4-DIENOIC ACID
sequence E
description (2Z,4E)-5-[(1S)-1-HYDROXY-2,6,6-TRIMETHYL-4-OXOCYCLOHEX-2-EN-1-YL]-3-METHYLPENTA-2,4-DIENOIC ACID binding site
source pdb_hetatom : A8S_3jrq_B_1

20) chain B
residue 135
type binding
ligand A8S: (2Z,4E)-5-[(1S)-1-HYDROXY-2,6,6-TRIMETHYL-4-OXOCYCLOHEX-2-EN-1-YL]-3-METHYLPENTA-2,4-DIENOIC ACID
sequence F
description (2Z,4E)-5-[(1S)-1-HYDROXY-2,6,6-TRIMETHYL-4-OXOCYCLOHEX-2-EN-1-YL]-3-METHYLPENTA-2,4-DIENOIC ACID binding site
source pdb_hetatom : A8S_3jrq_B_1

21) chain B
residue 137
type binding
ligand A8S: (2Z,4E)-5-[(1S)-1-HYDROXY-2,6,6-TRIMETHYL-4-OXOCYCLOHEX-2-EN-1-YL]-3-METHYLPENTA-2,4-DIENOIC ACID
sequence I
description (2Z,4E)-5-[(1S)-1-HYDROXY-2,6,6-TRIMETHYL-4-OXOCYCLOHEX-2-EN-1-YL]-3-METHYLPENTA-2,4-DIENOIC ACID binding site
source pdb_hetatom : A8S_3jrq_B_1

22) chain B
residue 142
type binding
ligand A8S: (2Z,4E)-5-[(1S)-1-HYDROXY-2,6,6-TRIMETHYL-4-OXOCYCLOHEX-2-EN-1-YL]-3-METHYLPENTA-2,4-DIENOIC ACID
sequence H
description (2Z,4E)-5-[(1S)-1-HYDROXY-2,6,6-TRIMETHYL-4-OXOCYCLOHEX-2-EN-1-YL]-3-METHYLPENTA-2,4-DIENOIC ACID binding site
source pdb_hetatom : A8S_3jrq_B_1

23) chain B
residue 144
type binding
ligand A8S: (2Z,4E)-5-[(1S)-1-HYDROXY-2,6,6-TRIMETHYL-4-OXOCYCLOHEX-2-EN-1-YL]-3-METHYLPENTA-2,4-DIENOIC ACID
sequence L
description (2Z,4E)-5-[(1S)-1-HYDROXY-2,6,6-TRIMETHYL-4-OXOCYCLOHEX-2-EN-1-YL]-3-METHYLPENTA-2,4-DIENOIC ACID binding site
source pdb_hetatom : A8S_3jrq_B_1

24) chain B
residue 147
type binding
ligand A8S: (2Z,4E)-5-[(1S)-1-HYDROXY-2,6,6-TRIMETHYL-4-OXOCYCLOHEX-2-EN-1-YL]-3-METHYLPENTA-2,4-DIENOIC ACID
sequence Y
description (2Z,4E)-5-[(1S)-1-HYDROXY-2,6,6-TRIMETHYL-4-OXOCYCLOHEX-2-EN-1-YL]-3-METHYLPENTA-2,4-DIENOIC ACID binding site
source pdb_hetatom : A8S_3jrq_B_1

25) chain B
residue 149
type binding
ligand A8S: (2Z,4E)-5-[(1S)-1-HYDROXY-2,6,6-TRIMETHYL-4-OXOCYCLOHEX-2-EN-1-YL]-3-METHYLPENTA-2,4-DIENOIC ACID
sequence S
description (2Z,4E)-5-[(1S)-1-HYDROXY-2,6,6-TRIMETHYL-4-OXOCYCLOHEX-2-EN-1-YL]-3-METHYLPENTA-2,4-DIENOIC ACID binding site
source pdb_hetatom : A8S_3jrq_B_1

26) chain B
residue 171
type binding
ligand A8S: (2Z,4E)-5-[(1S)-1-HYDROXY-2,6,6-TRIMETHYL-4-OXOCYCLOHEX-2-EN-1-YL]-3-METHYLPENTA-2,4-DIENOIC ACID
sequence E
description (2Z,4E)-5-[(1S)-1-HYDROXY-2,6,6-TRIMETHYL-4-OXOCYCLOHEX-2-EN-1-YL]-3-METHYLPENTA-2,4-DIENOIC ACID binding site
source pdb_hetatom : A8S_3jrq_B_1

27) chain B
residue 189-190
type binding
ligand A8S: (2Z,4E)-5-[(1S)-1-HYDROXY-2,6,6-TRIMETHYL-4-OXOCYCLOHEX-2-EN-1-YL]-3-METHYLPENTA-2,4-DIENOIC ACID
sequence FA
description (2Z,4E)-5-[(1S)-1-HYDROXY-2,6,6-TRIMETHYL-4-OXOCYCLOHEX-2-EN-1-YL]-3-METHYLPENTA-2,4-DIENOIC ACID binding site
source pdb_hetatom : A8S_3jrq_B_1

28) chain B
residue 193-194
type binding
ligand A8S: (2Z,4E)-5-[(1S)-1-HYDROXY-2,6,6-TRIMETHYL-4-OXOCYCLOHEX-2-EN-1-YL]-3-METHYLPENTA-2,4-DIENOIC ACID
sequence VI
description (2Z,4E)-5-[(1S)-1-HYDROXY-2,6,6-TRIMETHYL-4-OXOCYCLOHEX-2-EN-1-YL]-3-METHYLPENTA-2,4-DIENOIC ACID binding site
source pdb_hetatom : A8S_3jrq_B_1

29) chain B
residue 197
type binding
ligand A8S: (2Z,4E)-5-[(1S)-1-HYDROXY-2,6,6-TRIMETHYL-4-OXOCYCLOHEX-2-EN-1-YL]-3-METHYLPENTA-2,4-DIENOIC ACID
sequence N
description (2Z,4E)-5-[(1S)-1-HYDROXY-2,6,6-TRIMETHYL-4-OXOCYCLOHEX-2-EN-1-YL]-3-METHYLPENTA-2,4-DIENOIC ACID binding site
source pdb_hetatom : A8S_3jrq_B_1


Display surface

Download
Links