eF-site ID 3jrq-A
PDB Code 3jrq
Chain A

click to enlarge
Title Crystal structure of (+)-ABA-bound PYL1 in complex with ABI1
Classification HYDROLASE/Hormone Receptor
Compound Protein phosphatase 2C 56
Source Arabidopsis thaliana (Mouse-ear cress) (Q8VZS8_ARATH)
Sequence A:  SVPLYGFTSICGRRPEMEDAVSTIPRFLQSRFDPQSAAHF
FGVYDGHGGSQVANYCRERMHLALAEEIAKEKPMLCDGDT
WLEKWKKALFNSFLRVDSEIESVAPETVGSTSVVAVVFPS
HIFVANCGDSRAVLCRGKTALPLSVDHKPDREDEAARIEA
AGGKVIQWNGARVFGVLAMSRSIGDRYLKPSIIPDPEVTA
VKRVKEDDCLILASDGVWDVMTDEEACEMARKRILLWGKD
PAAMSAAEYLSKLAIQRGSKDNISVVVVDLK
Description (1)  Protein phosphatase 2C 56 (E.C.3.1.3.16), Putative uncharacterized protein At5g46790


Functional site

1) chain A
residue 244
type METAL
ligand
sequence S
description Manganese 2 (By similarity)
source Swiss-Prot : SWS_FT_FI2

2) chain A
residue 310
type METAL
ligand
sequence A
description Manganese 2 (By similarity)
source Swiss-Prot : SWS_FT_FI2

3) chain A
residue 197
type SITE
ligand
sequence A
description Lock.
source Swiss-Prot : SWS_FT_FI4

4) chain A
residue 300
type binding
ligand A8S: (2Z,4E)-5-[(1S)-1-HYDROXY-2,6,6-TRIMETHYL-4-OXOCYCLOHEX-2-EN-1-YL]-3-METHYLPENTA-2,4-DIENOIC ACID
sequence W
description (2Z,4E)-5-[(1S)-1-HYDROXY-2,6,6-TRIMETHYL-4-OXOCYCLOHEX-2-EN-1-YL]-3-METHYLPENTA-2,4-DIENOIC ACID binding site
source pdb_hetatom : A8S_3jrq_B_1


Display surface

Download
Links