eF-site ID 3jcn-b PDB Code 3jcn Chain b click to enlarge Title Structures of ribosome-bound initiation factor 2 reveal the mechanism of subunit association: Initiation Complex I Classification RIBOSOME Compound 50S ribosomal protein L32 Source ORGANISM_SCIENTIFIC: Escherichia coli; Sequence b:  DTGAAAEPRAPVVTIMGHVDHGKTSLLDYIRSTKVASGEA GGITQHIGAYHVETENGMITFLDTPGHAAFTSMRARGAQA TDIVVLVVAADDGVMPQTIEAIQHAKAAQVPVVVAVNKID KPEADPDRVKNELSQYGILPEEWGGESQFVHVSAKAGTGI DELLDAILLQAEVLELKAVRKGMASGAVIESFLDKGRGPV ATVLVREGTLHKGDIVLCGFEYGRVRAMRNELGQEVLEAG PSIPVEILGLSGVPAAGDEVTVVRDEKKAREVALYRQGKF REVKLARQQKSKLENMFANMTEGEVHEVNIVLKADVQGSV EAISDSLLKLSTDEVKVKIIGSGVGGITETDATLAAASNA ILVGFNVRADASARKVIEAESLDLRYYSVIYNLIDEVKAA MSGMLSPELKQQIIGLAEVRDVFKSPKFGAIAGCMVTEGV VKRHNPIRVLRDNVVIYEGELESLRRFKDDVNEVRNGMEC GIGVKNYNDVRTGDVIEVFEIIEIQRTIA Description (1)  50S ribosomal protein L32, 50S ribosomal protein L33, 50S ribosomal protein L34, 50S ribosomal protein L35, 50S ribosomal protein L36, 50S ribosomal protein L2, 50S ribosomal protein L4, 50S ribosomal protein L5, 50S ribosomal protein L6, 50S ribosomal protein L9, 50S ribosomal protein L11, 50S ribosomal protein L13, 50S ribosomal protein L14, 50S ribosomal protein L15, 50S ribosomal protein L16, 50S ribosomal protein L17, 50S ribosomal protein L18, 50S ribosomal protein L19, 50S ribosomal protein L20, 50S ribosomal protein L21, 50S ribosomal protein L22, 50S ribosomal protein L23, 50S ribosomal protein L24, 50S ribosomal protein L25, 50S ribosomal protein L27, 50S ribosomal protein L28, 50S ribosomal protein L29, 50S ribosomal protein L30, Translation initiation factor IF-2, 30S ribosomal protein S3, 30S ribosomal protein S2, 30S ribosomal protein S5, 30S ribosomal protein S4, 30S ribosomal protein S7, 30S ribosomal protein S6, 30S ribosomal protein S9, 30S ribosomal protein S8, 30S ribosomal protein S11, 30S ribosomal protein S10, 30S ribosomal protein S13, 30S ribosomal protein S12, 30S ribosomal protein S15, 30S ribosomal protein S14, 30S ribosomal protein S17, 30S ribosomal protein S16, 30S ribosomal protein S19, 30S ribosomal protein S18, 30S ribosomal protein S21, 30S ribosomal protein S20 Functional site 1) chain b residue 814 type sequence G description BINDING SITE FOR RESIDUE FME v 101 source : AC1 2) chain b residue 815 type sequence C description BINDING SITE FOR RESIDUE FME v 101 source : AC1 3) chain b residue 846 type sequence R description BINDING SITE FOR RESIDUE FME v 101 source : AC1 4) chain b residue 847 type sequence R description BINDING SITE FOR RESIDUE FME v 101 source : AC1 5) chain b residue 848 type sequence F description BINDING SITE FOR RESIDUE FME v 101 source : AC1 6) chain b residue 860 type sequence E description BINDING SITE FOR RESIDUE FME v 101 source : AC1 7) chain b residue 861 type sequence C description BINDING SITE FOR RESIDUE FME v 101 source : AC1 8) chain b residue 862 type sequence G description BINDING SITE FOR RESIDUE FME v 101 source : AC1 9) chain b residue 399 type sequence H description BINDING SITE FOR RESIDUE GNP b 901 source : AC2 10) chain b residue 400 type sequence V description BINDING SITE FOR RESIDUE GNP b 901 source : AC2 11) chain b residue 401 type sequence D description BINDING SITE FOR RESIDUE GNP b 901 source : AC2 12) chain b residue 403 type sequence G description BINDING SITE FOR RESIDUE GNP b 901 source : AC2 13) chain b residue 404 type sequence K description BINDING SITE FOR RESIDUE GNP b 901 source : AC2 14) chain b residue 405 type sequence T description BINDING SITE FOR RESIDUE GNP b 901 source : AC2 15) chain b residue 406 type sequence S description BINDING SITE FOR RESIDUE GNP b 901 source : AC2 16) chain b residue 425 type sequence T description BINDING SITE FOR RESIDUE GNP b 901 source : AC2 17) chain b residue 446 type sequence P description BINDING SITE FOR RESIDUE GNP b 901 source : AC2 18) chain b residue 447 type sequence G description BINDING SITE FOR RESIDUE GNP b 901 source : AC2 19) chain b residue 498 type sequence N description BINDING SITE FOR RESIDUE GNP b 901 source : AC2 20) chain b residue 499 type sequence K description BINDING SITE FOR RESIDUE GNP b 901 source : AC2 21) chain b residue 502 type sequence K description BINDING SITE FOR RESIDUE GNP b 901 source : AC2 22) chain b residue 534 type sequence S description BINDING SITE FOR RESIDUE GNP b 901 source : AC2 23) chain b residue 535 type sequence A description BINDING SITE FOR RESIDUE GNP b 901 source : AC2 24) chain b residue 536 type sequence K description BINDING SITE FOR RESIDUE GNP b 901 source : AC2 25) chain b residue 840-862 type prosite sequence GELESLRRFKDDVNEVRNGMECG description IF2 Initiation factor 2 signature. GeLesLRRfKddvneVrnGmECG source prosite : PS01176 26) chain b residue 444 type MOD_RES sequence D description N-acetylalanine => ECO:0000269|PubMed:776663 source Swiss-Prot : SWS_FT_FI1 27) chain b residue 498 type MOD_RES sequence N description N-acetylalanine => ECO:0000269|PubMed:776663 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links