eF-site ID 3jat-A PDB Code 3jat Chain A click to enlarge Title Cryo-EM structure of GMPCPP-microtubule (14 protofilaments) decorated with kinesin Classification STRUCTURAL PROTEIN Compound Tubulin alpha-1B chain Source ORGANISM_COMMON: pig; ORGANISM_SCIENTIFIC: Sus scrofa; Sequence A:  MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPDSF NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHP EQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQC TGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEF SIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAI YDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALN VDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVA EITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVN AAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLA KVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYV GEGMEEGEFSEAREDMAALEKDYEEVGV Description Functional site 1) chain A residue 10 type sequence G description BINDING SITE FOR RESIDUE GTP A 501 source : BC8 2) chain A residue 11 type sequence Q description BINDING SITE FOR RESIDUE GTP A 501 source : BC8 3) chain A residue 12 type sequence A description BINDING SITE FOR RESIDUE GTP A 501 source : BC8 4) chain A residue 15 type sequence Q description BINDING SITE FOR RESIDUE GTP A 501 source : BC8 5) chain A residue 99 type sequence A description BINDING SITE FOR RESIDUE GTP A 501 source : BC8 6) chain A residue 101 type sequence N description BINDING SITE FOR RESIDUE GTP A 501 source : BC8 7) chain A residue 140 type sequence S description BINDING SITE FOR RESIDUE GTP A 501 source : BC8 8) chain A residue 143 type sequence G description BINDING SITE FOR RESIDUE GTP A 501 source : BC8 9) chain A residue 144 type sequence G description BINDING SITE FOR RESIDUE GTP A 501 source : BC8 10) chain A residue 145 type sequence T description BINDING SITE FOR RESIDUE GTP A 501 source : BC8 11) chain A residue 146 type sequence G description BINDING SITE FOR RESIDUE GTP A 501 source : BC8 12) chain A residue 171 type sequence I description BINDING SITE FOR RESIDUE GTP A 501 source : BC8 13) chain A residue 179 type sequence T description BINDING SITE FOR RESIDUE GTP A 501 source : BC8 14) chain A residue 183 type sequence E description BINDING SITE FOR RESIDUE GTP A 501 source : BC8 15) chain A residue 206 type sequence N description BINDING SITE FOR RESIDUE GTP A 501 source : BC8 16) chain A residue 224 type sequence Y description BINDING SITE FOR RESIDUE GTP A 501 source : BC8 17) chain A residue 228 type sequence N description BINDING SITE FOR RESIDUE GTP A 501 source : BC8 18) chain A residue 71 type sequence E description BINDING SITE FOR RESIDUE MG A 502 source : BC9 19) chain A residue 254 type sequence E description BINDING SITE FOR RESIDUE G2P B 501 source : CC1 20) chain A residue 326 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000250|UniProtKB:P68363 source Swiss-Prot : SWS_FT_FI12 21) chain A residue 370 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000250|UniProtKB:P68363 source Swiss-Prot : SWS_FT_FI12 22) chain A residue 11 type BINDING sequence Q description BINDING => ECO:0000250|UniProtKB:P68363 source Swiss-Prot : SWS_FT_FI2 23) chain A residue 71 type BINDING sequence E description BINDING => ECO:0000250|UniProtKB:P68363 source Swiss-Prot : SWS_FT_FI2 24) chain A residue 140 type BINDING sequence S description BINDING => ECO:0000250|UniProtKB:P68363 source Swiss-Prot : SWS_FT_FI2 25) chain A residue 144 type BINDING sequence G description BINDING => ECO:0000250|UniProtKB:P68363 source Swiss-Prot : SWS_FT_FI2 26) chain A residue 145 type BINDING sequence T description BINDING => ECO:0000250|UniProtKB:P68363 source Swiss-Prot : SWS_FT_FI2 27) chain A residue 179 type BINDING sequence T description BINDING => ECO:0000250|UniProtKB:P68363 source Swiss-Prot : SWS_FT_FI2 28) chain A residue 206 type BINDING sequence N description BINDING => ECO:0000250|UniProtKB:P68363 source Swiss-Prot : SWS_FT_FI2 29) chain A residue 228 type BINDING sequence N description BINDING => ECO:0000250|UniProtKB:P68363 source Swiss-Prot : SWS_FT_FI2 30) chain A residue 48 type MOD_RES sequence S description Phosphoserine; by CDK1 => ECO:0000250|UniProtKB:Q13885 source Swiss-Prot : SWS_FT_FI5 31) chain A residue 232 type MOD_RES sequence S description Phosphoserine; by CDK1 => ECO:0000250|UniProtKB:Q13885 source Swiss-Prot : SWS_FT_FI5

Display surface Download Links