eF-site ID 3jar-A PDB Code 3jar Chain A click to enlarge Title Cryo-EM structure of GDP-microtubule co-polymerized with EB3 Classification STRUCTURAL PROTEIN Compound Tubulin alpha-1B chain Source ORGANISM_COMMON: pig; ORGANISM_SCIENTIFIC: Sus scrofa; Sequence A:  MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPDSF NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHP EQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQC TGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEF SIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAI YDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALN VDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVA EITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVN AAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLA KVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYV GEGMEEGEFSEAREDMAALEKDYEEVGVDSVE Description Functional site 1) chain A residue 11 type sequence Q description BINDING SITE FOR RESIDUE GTP A 501 source : BC4 2) chain A residue 12 type sequence A description BINDING SITE FOR RESIDUE GTP A 501 source : BC4 3) chain A residue 15 type sequence Q description BINDING SITE FOR RESIDUE GTP A 501 source : BC4 4) chain A residue 98 type sequence D description BINDING SITE FOR RESIDUE GTP A 501 source : BC4 5) chain A residue 99 type sequence A description BINDING SITE FOR RESIDUE GTP A 501 source : BC4 6) chain A residue 100 type sequence A description BINDING SITE FOR RESIDUE GTP A 501 source : BC4 7) chain A residue 101 type sequence N description BINDING SITE FOR RESIDUE GTP A 501 source : BC4 8) chain A residue 140 type sequence S description BINDING SITE FOR RESIDUE GTP A 501 source : BC4 9) chain A residue 143 type sequence G description BINDING SITE FOR RESIDUE GTP A 501 source : BC4 10) chain A residue 144 type sequence G description BINDING SITE FOR RESIDUE GTP A 501 source : BC4 11) chain A residue 145 type sequence T description BINDING SITE FOR RESIDUE GTP A 501 source : BC4 12) chain A residue 146 type sequence G description BINDING SITE FOR RESIDUE GTP A 501 source : BC4 13) chain A residue 171 type sequence I description BINDING SITE FOR RESIDUE GTP A 501 source : BC4 14) chain A residue 179 type sequence T description BINDING SITE FOR RESIDUE GTP A 501 source : BC4 15) chain A residue 183 type sequence E description BINDING SITE FOR RESIDUE GTP A 501 source : BC4 16) chain A residue 206 type sequence N description BINDING SITE FOR RESIDUE GTP A 501 source : BC4 17) chain A residue 224 type sequence Y description BINDING SITE FOR RESIDUE GTP A 501 source : BC4 18) chain A residue 228 type sequence N description BINDING SITE FOR RESIDUE GTP A 501 source : BC4 19) chain A residue 71 type sequence E description BINDING SITE FOR RESIDUE MG A 502 source : BC5 20) chain A residue 11 type MOD_RES sequence Q description Phosphoserine => ECO:0000250|UniProtKB:Q6PER3 source Swiss-Prot : SWS_FT_FI2 21) chain A residue 71 type MOD_RES sequence E description Phosphoserine => ECO:0000250|UniProtKB:Q6PER3 source Swiss-Prot : SWS_FT_FI2 22) chain A residue 140 type MOD_RES sequence S description Phosphoserine => ECO:0000250|UniProtKB:Q6PER3 source Swiss-Prot : SWS_FT_FI2 23) chain A residue 144 type MOD_RES sequence G description Phosphoserine => ECO:0000250|UniProtKB:Q6PER3 source Swiss-Prot : SWS_FT_FI2 24) chain A residue 145 type MOD_RES sequence T description Phosphoserine => ECO:0000250|UniProtKB:Q6PER3 source Swiss-Prot : SWS_FT_FI2 25) chain A residue 179 type MOD_RES sequence T description Phosphoserine => ECO:0000250|UniProtKB:Q6PER3 source Swiss-Prot : SWS_FT_FI2 26) chain A residue 206 type MOD_RES sequence N description Phosphoserine => ECO:0000250|UniProtKB:Q6PER3 source Swiss-Prot : SWS_FT_FI2 27) chain A residue 228 type MOD_RES sequence N description Phosphoserine => ECO:0000250|UniProtKB:Q6PER3 source Swiss-Prot : SWS_FT_FI2 28) chain A residue 326 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000250|UniProtKB:P68363 source Swiss-Prot : SWS_FT_FI12 29) chain A residue 370 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000250|UniProtKB:P68363 source Swiss-Prot : SWS_FT_FI12 30) chain A residue 232 type MOD_RES sequence S description Phosphoserine; by CDK1 => ECO:0000250|UniProtKB:Q13885 source Swiss-Prot : SWS_FT_FI5 31) chain A residue 48 type MOD_RES sequence S description Phosphoserine; by CDK1 => ECO:0000250|UniProtKB:Q13885 source Swiss-Prot : SWS_FT_FI5

Display surface Download Links