eF-site ID 3jam-R
PDB Code 3jam
Chain R

click to enlarge
Title CryoEM structure of 40S-eIF1A-eIF1 complex from yeast
Classification TRANSLATION
Compound 18S rRNA
Source ORGANISM_SCIENTIFIC: Kluyveromyces lactis;
Sequence R:  GRVRTKTVKRASKALIEKYYPKLTMDFQTNKRLCDEIATI
QSKRLRNKIAGYTTHLMKRIQKGPVRGISFKLQEEERERK
DQYVPDVSALDLSHSNDVLNVDTQTAELVNSLGLKLPLSV
SSVSA
Description (1)  PROTEIN/RNA Complex


Functional site

1) chain R
residue 41-56
type prosite
ligand
sequence IQSKRLRNKIAGYTTH
description Ribosomal protein S17e signature.[IVDYPKS]-x-[ST]-K-x-[LIVMTF]-[RIKM]-N-x-[IV]-[SA]-G-[FY]-x-[TV]-[HKRA].
source prosite : PS00712


Display surface

Download
Links