eF-site ID 3j9p-ABCD
PDB Code 3j9p
Chain A, B, C, D
Title Structure of the TRPA1 ion channel determined by electron cryo-microscopy
Classification TRANSPORT PROTEIN
Compound Maltose-binding periplasmic protein, Transient receptor potential cation channel subfamily A member 1 chimera
Source Homo sapiens (Human) (TRPA1_HUMAN)
Sequence A:  KKSPLHFAASYGRINTCQRLLQDISDTRLLNEGDLHGMTP
LHLAAKNGHDKVVQLLLKKGALFLSDHNGWTALHHASMGG
YTQTMKVILDTNLKCTDRLDEDGNTALHFAAREGHAKAVA
LLLSHNADIVLNKQQASFLHLALHNKRKEVVLTIIRSKRW
DECLKIFSHNSPGNKCPITEMIEYLPECMKVLLDFCMLHS
TEDKSCRDYYIEYNFKYLYEPLTALNAMVQNNRIELLNHP
VCKEYLLMKWLAYGFRAHMMNLGSYCLGLIPMTILVVNIK
PGMAFNTTNSYLIKTCMILVFLSSIFGYISNVLEWIIYTT
GIIFVLPLFVEIPAHLQWQCGAIAVYFYWMNFLLYLQRFE
NCGIFIVMLEVILKTLLRSTVVFIFLLLAFGLSFYILLNL
QDPFSSPLLSIIQTFSMMLGDINYRESFLEPYLRNELAHP
VLSFAQLVSFTIFVPIVLMNLLIGLAVGDIADVQKHASLK
RIAMQVELHTSLEKKLPLWFLRKVDQKSTIVYQEIPNADK
SLEMEILKQKYRLKDLTFLLEKQHELIKLIIQKMEIISET
B:  KKSPLHFAASYGRINTCQRLLQDISDTRLLNEGDLHGMTP
LHLAAKNGHDKVVQLLLKKGALFLSDHNGWTALHHASMGG
YTQTMKVILDTNLKCTDRLDEDGNTALHFAAREGHAKAVA
LLLSHNADIVLNKQQASFLHLALHNKRKEVVLTIIRSKRW
DECLKIFSHNSPGNKCPITEMIEYLPECMKVLLDFCMLHS
TEDKSCRDYYIEYNFKYLYEPLTALNAMVQNNRIELLNHP
VCKEYLLMKWLAYGFRAHMMNLGSYCLGLIPMTILVVNIK
PGMAFNTTNSYLIKTCMILVFLSSIFGYISNVLEWIIYTT
GIIFVLPLFVEIPAHLQWQCGAIAVYFYWMNFLLYLQRFE
NCGIFIVMLEVILKTLLRSTVVFIFLLLAFGLSFYILLNL
QDPFSSPLLSIIQTFSMMLGDINYRESFLEPYLRNELAHP
VLSFAQLVSFTIFVPIVLMNLLIGLAVGDIADVQKHASLK
RIAMQVELHTSLEKKLPLWFLRKVDQKSTIVYQEIPNADK
SLEMEILKQKYRLKDLTFLLEKQHELIKLIIQKMEIISET
C:  KKSPLHFAASYGRINTCQRLLQDISDTRLLNEGDLHGMTP
LHLAAKNGHDKVVQLLLKKGALFLSDHNGWTALHHASMGG
YTQTMKVILDTNLKCTDRLDEDGNTALHFAAREGHAKAVA
LLLSHNADIVLNKQQASFLHLALHNKRKEVVLTIIRSKRW
DECLKIFSHNSPGNKCPITEMIEYLPECMKVLLDFCMLHS
TEDKSCRDYYIEYNFKYLYEPLTALNAMVQNNRIELLNHP
VCKEYLLMKWLAYGFRAHMMNLGSYCLGLIPMTILVVNIK
PGMAFNTTNSYLIKTCMILVFLSSIFGYISNVLEWIIYTT
GIIFVLPLFVEIPAHLQWQCGAIAVYFYWMNFLLYLQRFE
NCGIFIVMLEVILKTLLRSTVVFIFLLLAFGLSFYILLNL
QDPFSSPLLSIIQTFSMMLGDINYRESFLEPYLRNELAHP
VLSFAQLVSFTIFVPIVLMNLLIGLAVGDIADVQKHASLK
RIAMQVELHTSLEKKLPLWFLRKVDQKSTIVYQEIPNADK
SLEMEILKQKYRLKDLTFLLEKQHELIKLIIQKMEIISET
D:  KKSPLHFAASYGRINTCQRLLQDISDTRLLNEGDLHGMTP
LHLAAKNGHDKVVQLLLKKGALFLSDHNGWTALHHASMGG
YTQTMKVILDTNLKCTDRLDEDGNTALHFAAREGHAKAVA
LLLSHNADIVLNKQQASFLHLALHNKRKEVVLTIIRSKRW
DECLKIFSHNSPGNKCPITEMIEYLPECMKVLLDFCMLHS
TEDKSCRDYYIEYNFKYLYEPLTALNAMVQNNRIELLNHP
VCKEYLLMKWLAYGFRAHMMNLGSYCLGLIPMTILVVNIK
PGMAFNTTNSYLIKTCMILVFLSSIFGYISNVLEWIIYTT
GIIFVLPLFVEIPAHLQWQCGAIAVYFYWMNFLLYLQRFE
NCGIFIVMLEVILKTLLRSTVVFIFLLLAFGLSFYILLNL
QDPFSSPLLSIIQTFSMMLGDINYRESFLEPYLRNELAHP
VLSFAQLVSFTIFVPIVLMNLLIGLAVGDIADVQKHASLK
RIAMQVELHTSLEKKLPLWFLRKVDQKSTIVYQEIPNADK
SLEMEILKQKYRLKDLTFLLEKQHELIKLIIQKMEIISET
Description (1)  Transient receptor potential cation channel subfamily A member 1

Display surface

Download
Links