eF-site ID 3j94-A PDB Code 3j94 Chain A click to enlarge Title Structure of ATP-bound N-ethylmaleimide sensitive factor determined by single particle cryoelectron microscopy Classification HYDROLASE Compound Vesicle-fusing ATPase Source (NSF_CRIGR) Sequence A:  FEKMGIGGLDKEFSDIFRRAFASRVFPPEIVEQMGCKHVK GILLYGPPGCGKTLLARQIGKMLNAREPKVVNGPEILNKY VGESEANIRKLFADAEEEQRRLGANSGLHIIIFDEIDAIC HDTVVNQLLSKIDGVEQLNNILVIGMTNRPDLIDEALLRP GRLEVKMEIGLPDEKGRLQILHIHTARMRGHQLLSADVDI KELAVETKNFSGAELEGLVRAAQSTAMNRHIDFLASLEND IKPAFGTNQEDYASYIMNGIIKWGDPVTRVLDDGELLVQQ TKNSDRTPLVSVLLEGPPHSGKTALAAKIAEESNFPFIKI CSPDKMIGFSETAKCQAMKKIFDDAYKSQLSCVVVDDIER LLDYVPIGPRFSNLVLQALLVLLKKAPPQGRKLLIIGTTS RKDVLQEMEMLNAFSTTIHVPNIATGEQLLEALELLGNFK DKERTTIAQQVKGKKVWIGIKKLLMLIEMSLQMDPEYRVR KFLALLREEG Description Functional site 1) chain A residue 502 type sequence Y description BINDING SITE FOR RESIDUE ATP A 801 source : AC1 2) chain A residue 503 type sequence I description BINDING SITE FOR RESIDUE ATP A 801 source : AC1 3) chain A residue 504 type sequence M description BINDING SITE FOR RESIDUE ATP A 801 source : AC1 4) chain A residue 505 type sequence N description BINDING SITE FOR RESIDUE ATP A 801 source : AC1 5) chain A residue 506 type sequence G description BINDING SITE FOR RESIDUE ATP A 801 source : AC1 6) chain A residue 507 type sequence I description BINDING SITE FOR RESIDUE ATP A 801 source : AC1 7) chain A residue 546 type sequence H description BINDING SITE FOR RESIDUE ATP A 801 source : AC1 8) chain A residue 548 type sequence G description BINDING SITE FOR RESIDUE ATP A 801 source : AC1 9) chain A residue 549 type sequence K description BINDING SITE FOR RESIDUE ATP A 801 source : AC1 10) chain A residue 550 type sequence T description BINDING SITE FOR RESIDUE ATP A 801 source : AC1 11) chain A residue 551 type sequence A description BINDING SITE FOR RESIDUE ATP A 801 source : AC1 12) chain A residue 708 type sequence K description BINDING SITE FOR RESIDUE ATP A 801 source : AC1 13) chain A residue 711 type sequence L description BINDING SITE FOR RESIDUE ATP A 801 source : AC1 14) chain A residue 221 type sequence G description BINDING SITE FOR RESIDUE ATP A 802 source : AC2 15) chain A residue 264 type sequence C description BINDING SITE FOR RESIDUE ATP A 802 source : AC2 16) chain A residue 265 type sequence G description BINDING SITE FOR RESIDUE ATP A 802 source : AC2 17) chain A residue 267 type sequence T description BINDING SITE FOR RESIDUE ATP A 802 source : AC2 18) chain A residue 268 type sequence L description BINDING SITE FOR RESIDUE ATP A 802 source : AC2 19) chain A residue 328 type sequence D description BINDING SITE FOR RESIDUE ATP A 802 source : AC2 20) chain A residue 406 type sequence I description BINDING SITE FOR RESIDUE ATP A 802 source : AC2 21) chain A residue 438 type sequence G description BINDING SITE FOR RESIDUE ATP A 802 source : AC2 22) chain A residue 439 type sequence A description BINDING SITE FOR RESIDUE ATP A 802 source : AC2 23) chain A residue 442 type sequence E description BINDING SITE FOR RESIDUE ATP A 802 source : AC2 24) chain A residue 631 type sequence K description BINDING SITE FOR RESIDUE ATP B 801 source : AC3 25) chain A residue 505 type BINDING sequence N description BINDING => ECO:0000269|PubMed:9731775, ECO:0000305|PubMed:9727495 source Swiss-Prot : SWS_FT_FI1 26) chain A residue 545 type BINDING sequence P description BINDING => ECO:0000269|PubMed:9731775, ECO:0000305|PubMed:9727495 source Swiss-Prot : SWS_FT_FI1 27) chain A residue 550 type BINDING sequence T description BINDING => ECO:0000269|PubMed:9731775 source Swiss-Prot : SWS_FT_FI2 28) chain A residue 259 type MOD_RES sequence Y description Phosphotyrosine => ECO:0000250|UniProtKB:P46460 source Swiss-Prot : SWS_FT_FI5 29) chain A residue 569 type MOD_RES sequence S description Phosphoserine; by CDK16 => ECO:0000250|UniProtKB:P46460 source Swiss-Prot : SWS_FT_FI6 30) chain A residue 367-385 type prosite sequence ILVIGMTNRPDLIDEALLR description AAA AAA-protein family signature. IlVIgMTNrpdlIDeALl.R source prosite : PS00674 31) chain A residue 549 type catalytic sequence K description 642 source MCSA : MCSA1 32) chain A residue 550 type catalytic sequence T description 642 source MCSA : MCSA1 33) chain A residue 603 type catalytic sequence D description 642 source MCSA : MCSA1 34) chain A residue 604 type catalytic sequence D description 642 source MCSA : MCSA1 35) chain A residue 631 type catalytic sequence K description 642 source MCSA : MCSA1 36) chain A residue 708 type catalytic sequence K description 642 source MCSA : MCSA1

Display surface Download Links