eF-site ID 3j81-c PDB Code 3j81 Chain c click to enlarge Title CryoEM structure of a partial yeast 48S preinitiation complex Classification RIBOSOME Compound 18S rRNA Source ORGANISM_SCIENTIFIC: Kluyveromyces lactis; Sequence c:  PVTLAKVIKVLGRTGSRGGVTQVRVEFLEDTTRTIVRNVK GPVREGDILVLMESEREARRLR Description Functional site 1) chain c residue 58-66 type prosite sequence ESEREARRL description RIBOSOMAL_S28E Ribosomal protein S28e signature. ESEREARrL source prosite : PS00961

Display surface Download Links