eF-site ID 3j7l-B
PDB Code 3j7l
Chain B

click to enlarge
Title Full virus map of brome mosaic virus
Classification VIRUS
Compound Capsid protein
Source ORGANISM_COMMON: BMV; ORGANISM_SCIENTIFIC: Brome mosaic virus;
Sequence B:  RVQPVIVEPLAAGQGKAIKAIAGYSISKWEASSDAITAKA
TNAMSITLPHELSSEKNKELKVGRVLLWLGLLPSVAGRIK
ACVAEKQAQAEAAFQVALAVADSSKEVVAAMYTDAFRGAT
LGDLLNLQIYLYASEAVPAKAVVVHLEVEHVRPTFDDFFT
PVYR
Description (1)  Capsid protein

Display surface

Download
Links