eF-site ID 3j79-c PDB Code 3j79 Chain c click to enlarge Title Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine, large subunit Classification RIBOSOME/INHIBITOR Compound 28S ribosomal RNA Source ORGANISM_SCIENTIFIC: Plasmodium falciparum; Sequence c:  GKAGKGTGSFGKRNGKTHFLCLRCGKRSYHLQKKKCASCG YPSAKKRRFNWSVKAKRRNTTGTGRCRYIKTLRRKLKNKF TEGSTPKPK Description Functional site 1) chain c residue 33 type sequence Q description BINDING SITE FOR RESIDUE MG A 3930 source : NC9 2) chain c residue 22 type sequence C description BINDING SITE FOR RESIDUE ZN c 100 source : RC7 3) chain c residue 25 type sequence C description BINDING SITE FOR RESIDUE ZN c 100 source : RC7 4) chain c residue 37 type sequence C description BINDING SITE FOR RESIDUE ZN c 100 source : RC7 5) chain c residue 39 type sequence S description BINDING SITE FOR RESIDUE ZN c 100 source : RC7 6) chain c residue 40 type sequence C description BINDING SITE FOR RESIDUE ZN c 100 source : RC7 7) chain c residue 7-26 type prosite sequence GTGSFGKRNGKTHFLCLRCG description RIBOSOMAL_L37E Ribosomal protein L37e signature. GTgSfGkRngkt.HflClRCG source prosite : PS01077

Display surface Download Links