eF-site ID 3j5r-C
PDB Code 3j5r
Chain C

click to enlarge
Title Reconstruction of TRPV1 ion channel in complex with capsaicin by single particle cryo-microscopy
Classification TRANSPORT PROTEIN
Compound Transient receptor potential cation channel subfamily V member 1
Source (3J5R)
Sequence C:  LYDRRSIFDAVAQSNCQELESLLPFLQRSKKRLTDSEFKD
PETGKTCLLKAMLNLHNGQNDTIALLLDVARKTDSLKQFV
NASYTDSYYKGQTALHIAIERRNMTLVTLLVENGADVQAA
ANGDFFKKTKGRPGFYFGELPLSLAACTNQLAIVKFLLQN
SWQPADISARDSVGNTVLHALVEVADNTVDNTKFVTSMYN
EILILGAKLHPTLKLEEITNRKGLTPLALAASSGKIGVLA
YILQREIHEPECRHLSRKFTEWAYGPVHSSLYDLSCIDTC
EKNSVLEVIAYSSSETPNRHDMLLVEPLNRLLQDKWDRFV
KRIFYFNFFVYCLYMIIFTAAAYYRPVEGLPPYKLKNTVG
DYFRVTGEILSVSGGVYFFFRGIQYFLQRRPSVDSYSEIL
FFVQSLFMLVSVVLYFSQRKEYVASMVFSLAMGWTNMLYY
TRGFQQMGIYAVMIEKMILRDLCRFMFVYLVFLFGFSTAV
VTLIEDGKYNSLYSTCLELFKFTIGMGDLEFTENYDFKAV
FIILLLAYVILTYILLLNMLIALMGETVNKIAQESKNIWK
LQRAITILDTEKSFLKCMRKAXXXXXXXXXXX
Description (1)  Transient receptor potential cation channel subfamily V member 1

Display surface

Download
Links