eF-site ID 3j5q-B
PDB Code 3j5q
Chain B

click to enlarge
Title Structure of TRPV1 ion channel in complex with DkTx and RTX determined by single particle electron cryo-microscopy
Classification TRANSPORT PROTEIN/TOXIN
Compound Transient receptor potential cation channel subfamily V member 1
Source ORGANISM_COMMON: Chinese earth tiger tarantula; ORGANISM_SCIENTIFIC: Chilobrachys jingzhao;
Sequence B:  LYDRRSIFDAVAQSNCQELESLLPFLQRSKKRLTDSEFKD
PETGKTCLLKAMLNLHNGQNDTIALLLDVARKTDSLKQFV
NASYTDSYYKGQTALHIAIERRNMTLVTLLVENGADVQAA
ANGDFFKKTKGRPGFYFGELPLSLAACTNQLAIVKFLLQN
SWQPADISARDSVGNTVLHALVEVADNTVDNTKFVTSMYN
EILILGAKLHPTLKLEEITNRKGLTPLALAASSGKIGVLA
YILQREIHEPECRHLSRKFTEWAYGPVHSSLYDLSCIDTC
EKNSVLEVIAYSSSETPNRHDMLLVEPLNRLLQDKWDRFV
KRIFYFNFFVYCLYMIIFTAAAYYRPVEGLPPYKLKNTVG
DYFRVTGEILSVSGGVYFFFRGIQYFLQRRPSVDSYSEIL
FFVQSLFMLVSVVLYFSQRKEYVASMVFSLAMGWTNMLYY
TRGFQQMGIYAVMIEKMILRDLCRFMFVYLVFLFGFSTAV
VTLIEDGKYNSLYSTCLELFKFTIGMGDLEFTENYDFKAV
FIILLLAYVILTYILLLNMLIALMGETVNKIAQESKNIWK
LQRAITILDTEKSFLKCMRKAXXXXXXXXXXX
Description (1)  Transient receptor potential cation channel subfamily V member 1, Double-knot toxin

Display surface

Download
Links