eF-site ID 3j5q-ABCDEFGH
PDB Code 3j5q
Chain A, B, C, D, E, F, G, H

click to enlarge
Title Structure of TRPV1 ion channel in complex with DkTx and RTX determined by single particle electron cryo-microscopy
Classification TRANSPORT PROTEIN/TOXIN
Compound Transient receptor potential cation channel subfamily V member 1
Source ORGANISM_COMMON: Chinese earth tiger tarantula; ORGANISM_SCIENTIFIC: Chilobrachys jingzhao;
Sequence A:  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
B:  LYDRRSIFDAVAQSNCQELESLLPFLQRSKKRLTDSEFKD
PETGKTCLLKAMLNLHNGQNDTIALLLDVARKTDSLKQFV
NASYTDSYYKGQTALHIAIERRNMTLVTLLVENGADVQAA
ANGDFFKKTKGRPGFYFGELPLSLAACTNQLAIVKFLLQN
SWQPADISARDSVGNTVLHALVEVADNTVDNTKFVTSMYN
EILILGAKLHPTLKLEEITNRKGLTPLALAASSGKIGVLA
YILQREIHEPECRHLSRKFTEWAYGPVHSSLYDLSCIDTC
EKNSVLEVIAYSSSETPNRHDMLLVEPLNRLLQDKWDRFV
KRIFYFNFFVYCLYMIIFTAAAYYRPVEGLPPYKLKNTVG
DYFRVTGEILSVSGGVYFFFRGIQYFLQRRPSVDSYSEIL
FFVQSLFMLVSVVLYFSQRKEYVASMVFSLAMGWTNMLYY
TRGFQQMGIYAVMIEKMILRDLCRFMFVYLVFLFGFSTAV
VTLIEDGKYNSLYSTCLELFKFTIGMGDLEFTENYDFKAV
FIILLLAYVILTYILLLNMLIALMGETVNKIAQESKNIWK
LQRAITILDTEKSFLKCMRKAXXXXXXXXXXX
C:  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
D:  LYDRRSIFDAVAQSNCQELESLLPFLQRSKKRLTDSEFKD
PETGKTCLLKAMLNLHNGQNDTIALLLDVARKTDSLKQFV
NASYTDSYYKGQTALHIAIERRNMTLVTLLVENGADVQAA
ANGDFFKKTKGRPGFYFGELPLSLAACTNQLAIVKFLLQN
SWQPADISARDSVGNTVLHALVEVADNTVDNTKFVTSMYN
EILILGAKLHPTLKLEEITNRKGLTPLALAASSGKIGVLA
YILQREIHEPECRHLSRKFTEWAYGPVHSSLYDLSCIDTC
EKNSVLEVIAYSSSETPNRHDMLLVEPLNRLLQDKWDRFV
KRIFYFNFFVYCLYMIIFTAAAYYRPVEGLPPYKLKNTVG
DYFRVTGEILSVSGGVYFFFRGIQYFLQRRPSVDSYSEIL
FFVQSLFMLVSVVLYFSQRKEYVASMVFSLAMGWTNMLYY
TRGFQQMGIYAVMIEKMILRDLCRFMFVYLVFLFGFSTAV
VTLIEDGKYNSLYSTCLELFKFTIGMGDLEFTENYDFKAV
FIILLLAYVILTYILLLNMLIALMGETVNKIAQESKNIWK
LQRAITILDTEKSFLKCMRKAXXXXXXXXXXX
E:  LYDRRSIFDAVAQSNCQELESLLPFLQRSKKRLTDSEFKD
PETGKTCLLKAMLNLHNGQNDTIALLLDVARKTDSLKQFV
NASYTDSYYKGQTALHIAIERRNMTLVTLLVENGADVQAA
ANGDFFKKTKGRPGFYFGELPLSLAACTNQLAIVKFLLQN
SWQPADISARDSVGNTVLHALVEVADNTVDNTKFVTSMYN
EILILGAKLHPTLKLEEITNRKGLTPLALAASSGKIGVLA
YILQREIHEPECRHLSRKFTEWAYGPVHSSLYDLSCIDTC
EKNSVLEVIAYSSSETPNRHDMLLVEPLNRLLQDKWDRFV
KRIFYFNFFVYCLYMIIFTAAAYYRPVEGLPPYKLKNTVG
DYFRVTGEILSVSGGVYFFFRGIQYFLQRRPSVDSYSEIL
FFVQSLFMLVSVVLYFSQRKEYVASMVFSLAMGWTNMLYY
TRGFQQMGIYAVMIEKMILRDLCRFMFVYLVFLFGFSTAV
VTLIEDGKYNSLYSTCLELFKFTIGMGDLEFTENYDFKAV
FIILLLAYVILTYILLLNMLIALMGETVNKIAQESKNIWK
LQRAITILDTEKSFLKCMRKAXXXXXXXXXXX
F:  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
G:  LYDRRSIFDAVAQSNCQELESLLPFLQRSKKRLTDSEFKD
PETGKTCLLKAMLNLHNGQNDTIALLLDVARKTDSLKQFV
NASYTDSYYKGQTALHIAIERRNMTLVTLLVENGADVQAA
ANGDFFKKTKGRPGFYFGELPLSLAACTNQLAIVKFLLQN
SWQPADISARDSVGNTVLHALVEVADNTVDNTKFVTSMYN
EILILGAKLHPTLKLEEITNRKGLTPLALAASSGKIGVLA
YILQREIHEPECRHLSRKFTEWAYGPVHSSLYDLSCIDTC
EKNSVLEVIAYSSSETPNRHDMLLVEPLNRLLQDKWDRFV
KRIFYFNFFVYCLYMIIFTAAAYYRPVEGLPPYKLKNTVG
DYFRVTGEILSVSGGVYFFFRGIQYFLQRRPSVDSYSEIL
FFVQSLFMLVSVVLYFSQRKEYVASMVFSLAMGWTNMLYY
TRGFQQMGIYAVMIEKMILRDLCRFMFVYLVFLFGFSTAV
VTLIEDGKYNSLYSTCLELFKFTIGMGDLEFTENYDFKAV
FIILLLAYVILTYILLLNMLIALMGETVNKIAQESKNIWK
LQRAITILDTEKSFLKCMRKAXXXXXXXXXXX
H:  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Description (1)  Transient receptor potential cation channel subfamily V member 1, Double-knot toxin

Display surface

Download
Links