eF-site ID 3j3w-2 PDB Code 3j3w Chain 2 click to enlarge Title Atomic model of the immature 50S subunit from Bacillus subtilis (state II-a) Classification RIBOSOME Compound ribosome RNA 23S Source ORGANISM_SCIENTIFIC: Bacillus subtilis; Sequence 2:  MKRTFQPNNRKRSKVHGFRSRMSSKNGRLVLARRRRKGRK VLSA Description Functional site 1) chain 2 residue 2-21 type prosite sequence KRTFQPNNRKRSKVHGFRSR description RIBOSOMAL_L34 Ribosomal protein L34 signature. KRTFQpnnrkRskvh.GFrsR source prosite : PS00784

Display surface Download Links