|
|
eF-site ID
|
3j3v-5 |
|
PDB Code
|
3j3v |
|
Chain
|
5 |
|
click to enlarge
|
|
|
Title
|
Atomic model of the immature 50S subunit from Bacillus subtilis (state I-a) |
|
Classification
|
RIBOSOME |
|
Compound
|
50S ribosomal protein L32 |
|
Source
|
ORGANISM_SCIENTIFIC: Bacillus subtilis; |
|
|
Sequence
|
5: |
AKKGKKYVEAAKLVDRSKAYDVSEAVALVKKTNTAKFDAT
VEVAFRLGVDPRKNDQQDKAGNIHVPIGKVSFEDEKLVEN
FTTMYDTILKAKPAAAKGVYVKNVAVTSTMGPGVKVDSST
|
|
|
Description
|
|
|
|