eF-site ID 3j2t-N PDB Code 3j2t Chain N click to enlarge Title An improved model of the human apoptosome Classification APOPTOSIS Compound Apoptotic protease-activating factor 1 Source ORGANISM_COMMON: bovine; ORGANISM_SCIENTIFIC: Bos taurus; Sequence N:  GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKT GQAPGFSYTDANKNKGITWGEETLMEYLENPKKYIPGTKM IFAGIKKKGEREDLIAYLKKATNE Description (1)  Apoptotic protease-activating factor 1, Cytochrome c Functional site 1) chain N residue 13 type sequence K description BINDING SITE FOR RESIDUE HEM N 500 source : BC5 2) chain N residue 14 type sequence C description BINDING SITE FOR RESIDUE HEM N 500 source : BC5 3) chain N residue 16 type sequence Q description BINDING SITE FOR RESIDUE HEM N 500 source : BC5 4) chain N residue 17 type sequence C description BINDING SITE FOR RESIDUE HEM N 500 source : BC5 5) chain N residue 18 type sequence H description BINDING SITE FOR RESIDUE HEM N 500 source : BC5 6) chain N residue 28 type sequence T description BINDING SITE FOR RESIDUE HEM N 500 source : BC5 7) chain N residue 30 type sequence P description BINDING SITE FOR RESIDUE HEM N 500 source : BC5 8) chain N residue 40 type sequence T description BINDING SITE FOR RESIDUE HEM N 500 source : BC5 9) chain N residue 41 type sequence G description BINDING SITE FOR RESIDUE HEM N 500 source : BC5 10) chain N residue 48 type sequence Y description BINDING SITE FOR RESIDUE HEM N 500 source : BC5 11) chain N residue 49 type sequence T description BINDING SITE FOR RESIDUE HEM N 500 source : BC5 12) chain N residue 52 type sequence N description BINDING SITE FOR RESIDUE HEM N 500 source : BC5 13) chain N residue 59 type sequence W description BINDING SITE FOR RESIDUE HEM N 500 source : BC5 14) chain N residue 67 type sequence Y description BINDING SITE FOR RESIDUE HEM N 500 source : BC5 15) chain N residue 68 type sequence L description BINDING SITE FOR RESIDUE HEM N 500 source : BC5 16) chain N residue 78 type sequence T description BINDING SITE FOR RESIDUE HEM N 500 source : BC5 17) chain N residue 79 type sequence K description BINDING SITE FOR RESIDUE HEM N 500 source : BC5 18) chain N residue 80 type sequence M description BINDING SITE FOR RESIDUE HEM N 500 source : BC5 19) chain N residue 81 type sequence I description BINDING SITE FOR RESIDUE HEM N 500 source : BC5 20) chain N residue 82 type sequence F description BINDING SITE FOR RESIDUE HEM N 500 source : BC5 21) chain N residue 99 type MOD_RES sequence K description N6-acetyllysine => ECO:0000250|UniProtKB:P62897 source Swiss-Prot : SWS_FT_FI8 22) chain N residue 1 type MOD_RES sequence G description N-acetylglycine => ECO:0000269|PubMed:5933874 source Swiss-Prot : SWS_FT_FI3 23) chain N residue 48 type MOD_RES sequence Y description Phosphotyrosine => ECO:0000269|PubMed:16866357 source Swiss-Prot : SWS_FT_FI4 24) chain N residue 55 type MOD_RES sequence K description N6-succinyllysine => ECO:0000250|UniProtKB:P62897 source Swiss-Prot : SWS_FT_FI5 25) chain N residue 72 type MOD_RES sequence K description N6-succinyllysine; alternate => ECO:0000250|UniProtKB:P62897 source Swiss-Prot : SWS_FT_FI6 26) chain N residue 97 type MOD_RES sequence Y description Phosphotyrosine => ECO:0000269|PubMed:18471988 source Swiss-Prot : SWS_FT_FI7 27) chain N residue 14 type BINDING sequence C description covalent source Swiss-Prot : SWS_FT_FI1 28) chain N residue 17 type BINDING sequence C description covalent source Swiss-Prot : SWS_FT_FI1 29) chain N residue 18 type BINDING sequence H description axial binding residue source Swiss-Prot : SWS_FT_FI2 30) chain N residue 80 type BINDING sequence M description axial binding residue source Swiss-Prot : SWS_FT_FI2

Display surface Download Links