eF-site ID 3j2t-M PDB Code 3j2t Chain M click to enlarge Title An improved model of the human apoptosome Classification APOPTOSIS Compound Apoptotic protease-activating factor 1 Source ORGANISM_COMMON: bovine; ORGANISM_SCIENTIFIC: Bos taurus; Sequence M:  GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKT GQAPGFSYTDANKNKGITWGEETLMEYLENPKKYIPGTKM IFAGIKKKGEREDLIAYLKKATNE Description (1)  Apoptotic protease-activating factor 1, Cytochrome c Functional site 1) chain M residue 13 type sequence K description BINDING SITE FOR RESIDUE HEM M 500 source : BC4 2) chain M residue 14 type sequence C description BINDING SITE FOR RESIDUE HEM M 500 source : BC4 3) chain M residue 16 type sequence Q description BINDING SITE FOR RESIDUE HEM M 500 source : BC4 4) chain M residue 17 type sequence C description BINDING SITE FOR RESIDUE HEM M 500 source : BC4 5) chain M residue 18 type sequence H description BINDING SITE FOR RESIDUE HEM M 500 source : BC4 6) chain M residue 28 type sequence T description BINDING SITE FOR RESIDUE HEM M 500 source : BC4 7) chain M residue 30 type sequence P description BINDING SITE FOR RESIDUE HEM M 500 source : BC4 8) chain M residue 40 type sequence T description BINDING SITE FOR RESIDUE HEM M 500 source : BC4 9) chain M residue 41 type sequence G description BINDING SITE FOR RESIDUE HEM M 500 source : BC4 10) chain M residue 48 type sequence Y description BINDING SITE FOR RESIDUE HEM M 500 source : BC4 11) chain M residue 49 type sequence T description BINDING SITE FOR RESIDUE HEM M 500 source : BC4 12) chain M residue 52 type sequence N description BINDING SITE FOR RESIDUE HEM M 500 source : BC4 13) chain M residue 59 type sequence W description BINDING SITE FOR RESIDUE HEM M 500 source : BC4 14) chain M residue 67 type sequence Y description BINDING SITE FOR RESIDUE HEM M 500 source : BC4 15) chain M residue 68 type sequence L description BINDING SITE FOR RESIDUE HEM M 500 source : BC4 16) chain M residue 78 type sequence T description BINDING SITE FOR RESIDUE HEM M 500 source : BC4 17) chain M residue 79 type sequence K description BINDING SITE FOR RESIDUE HEM M 500 source : BC4 18) chain M residue 80 type sequence M description BINDING SITE FOR RESIDUE HEM M 500 source : BC4 19) chain M residue 81 type sequence I description BINDING SITE FOR RESIDUE HEM M 500 source : BC4 20) chain M residue 82 type sequence F description BINDING SITE FOR RESIDUE HEM M 500 source : BC4 21) chain M residue 14 type BINDING sequence C description covalent source Swiss-Prot : SWS_FT_FI1 22) chain M residue 17 type BINDING sequence C description covalent source Swiss-Prot : SWS_FT_FI1 23) chain M residue 1 type MOD_RES sequence G description N-acetylglycine => ECO:0000269|PubMed:5933874 source Swiss-Prot : SWS_FT_FI3 24) chain M residue 48 type MOD_RES sequence Y description Phosphotyrosine => ECO:0000269|PubMed:16866357 source Swiss-Prot : SWS_FT_FI4 25) chain M residue 18 type BINDING sequence H description axial binding residue source Swiss-Prot : SWS_FT_FI2 26) chain M residue 80 type BINDING sequence M description axial binding residue source Swiss-Prot : SWS_FT_FI2 27) chain M residue 99 type MOD_RES sequence K description N6-acetyllysine => ECO:0000250|UniProtKB:P62897 source Swiss-Prot : SWS_FT_FI8 28) chain M residue 55 type MOD_RES sequence K description N6-succinyllysine => ECO:0000250|UniProtKB:P62897 source Swiss-Prot : SWS_FT_FI5 29) chain M residue 72 type MOD_RES sequence K description N6-succinyllysine; alternate => ECO:0000250|UniProtKB:P62897 source Swiss-Prot : SWS_FT_FI6 30) chain M residue 97 type MOD_RES sequence Y description Phosphotyrosine => ECO:0000269|PubMed:18471988 source Swiss-Prot : SWS_FT_FI7

Display surface Download Links