eF-site ID 3j2t-L PDB Code 3j2t Chain L click to enlarge Title An improved model of the human apoptosome Classification APOPTOSIS Compound Apoptotic protease-activating factor 1 Source ORGANISM_COMMON: bovine; ORGANISM_SCIENTIFIC: Bos taurus; Sequence L:  GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKT GQAPGFSYTDANKNKGITWGEETLMEYLENPKKYIPGTKM IFAGIKKKGEREDLIAYLKKATNE Description (1)  Apoptotic protease-activating factor 1, Cytochrome c Functional site 1) chain L residue 13 type sequence K description BINDING SITE FOR RESIDUE HEM L 500 source : BC3 2) chain L residue 14 type sequence C description BINDING SITE FOR RESIDUE HEM L 500 source : BC3 3) chain L residue 16 type sequence Q description BINDING SITE FOR RESIDUE HEM L 500 source : BC3 4) chain L residue 17 type sequence C description BINDING SITE FOR RESIDUE HEM L 500 source : BC3 5) chain L residue 18 type sequence H description BINDING SITE FOR RESIDUE HEM L 500 source : BC3 6) chain L residue 28 type sequence T description BINDING SITE FOR RESIDUE HEM L 500 source : BC3 7) chain L residue 30 type sequence P description BINDING SITE FOR RESIDUE HEM L 500 source : BC3 8) chain L residue 40 type sequence T description BINDING SITE FOR RESIDUE HEM L 500 source : BC3 9) chain L residue 41 type sequence G description BINDING SITE FOR RESIDUE HEM L 500 source : BC3 10) chain L residue 48 type sequence Y description BINDING SITE FOR RESIDUE HEM L 500 source : BC3 11) chain L residue 49 type sequence T description BINDING SITE FOR RESIDUE HEM L 500 source : BC3 12) chain L residue 52 type sequence N description BINDING SITE FOR RESIDUE HEM L 500 source : BC3 13) chain L residue 59 type sequence W description BINDING SITE FOR RESIDUE HEM L 500 source : BC3 14) chain L residue 67 type sequence Y description BINDING SITE FOR RESIDUE HEM L 500 source : BC3 15) chain L residue 68 type sequence L description BINDING SITE FOR RESIDUE HEM L 500 source : BC3 16) chain L residue 78 type sequence T description BINDING SITE FOR RESIDUE HEM L 500 source : BC3 17) chain L residue 79 type sequence K description BINDING SITE FOR RESIDUE HEM L 500 source : BC3 18) chain L residue 80 type sequence M description BINDING SITE FOR RESIDUE HEM L 500 source : BC3 19) chain L residue 81 type sequence I description BINDING SITE FOR RESIDUE HEM L 500 source : BC3 20) chain L residue 82 type sequence F description BINDING SITE FOR RESIDUE HEM L 500 source : BC3 21) chain L residue 17 type BINDING sequence C description covalent source Swiss-Prot : SWS_FT_FI1 22) chain L residue 14 type BINDING sequence C description covalent source Swiss-Prot : SWS_FT_FI1 23) chain L residue 1 type MOD_RES sequence G description N-acetylglycine => ECO:0000269|PubMed:5933874 source Swiss-Prot : SWS_FT_FI3 24) chain L residue 48 type MOD_RES sequence Y description Phosphotyrosine => ECO:0000269|PubMed:16866357 source Swiss-Prot : SWS_FT_FI4 25) chain L residue 80 type BINDING sequence M description axial binding residue source Swiss-Prot : SWS_FT_FI2 26) chain L residue 18 type BINDING sequence H description axial binding residue source Swiss-Prot : SWS_FT_FI2 27) chain L residue 99 type MOD_RES sequence K description N6-acetyllysine => ECO:0000250|UniProtKB:P62897 source Swiss-Prot : SWS_FT_FI8 28) chain L residue 55 type MOD_RES sequence K description N6-succinyllysine => ECO:0000250|UniProtKB:P62897 source Swiss-Prot : SWS_FT_FI5 29) chain L residue 72 type MOD_RES sequence K description N6-succinyllysine; alternate => ECO:0000250|UniProtKB:P62897 source Swiss-Prot : SWS_FT_FI6 30) chain L residue 97 type MOD_RES sequence Y description Phosphotyrosine => ECO:0000269|PubMed:18471988 source Swiss-Prot : SWS_FT_FI7

Display surface Download Links