eF-site ID 3j2t-K PDB Code 3j2t Chain K click to enlarge Title An improved model of the human apoptosome Classification APOPTOSIS Compound Apoptotic protease-activating factor 1 Source ORGANISM_COMMON: bovine; ORGANISM_SCIENTIFIC: Bos taurus; Sequence K:  GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKT GQAPGFSYTDANKNKGITWGEETLMEYLENPKKYIPGTKM IFAGIKKKGEREDLIAYLKKATNE Description (1)  Apoptotic protease-activating factor 1, Cytochrome c Functional site 1) chain K residue 13 type sequence K description BINDING SITE FOR RESIDUE HEM K 500 source : BC2 2) chain K residue 14 type sequence C description BINDING SITE FOR RESIDUE HEM K 500 source : BC2 3) chain K residue 16 type sequence Q description BINDING SITE FOR RESIDUE HEM K 500 source : BC2 4) chain K residue 17 type sequence C description BINDING SITE FOR RESIDUE HEM K 500 source : BC2 5) chain K residue 18 type sequence H description BINDING SITE FOR RESIDUE HEM K 500 source : BC2 6) chain K residue 28 type sequence T description BINDING SITE FOR RESIDUE HEM K 500 source : BC2 7) chain K residue 30 type sequence P description BINDING SITE FOR RESIDUE HEM K 500 source : BC2 8) chain K residue 40 type sequence T description BINDING SITE FOR RESIDUE HEM K 500 source : BC2 9) chain K residue 41 type sequence G description BINDING SITE FOR RESIDUE HEM K 500 source : BC2 10) chain K residue 48 type sequence Y description BINDING SITE FOR RESIDUE HEM K 500 source : BC2 11) chain K residue 49 type sequence T description BINDING SITE FOR RESIDUE HEM K 500 source : BC2 12) chain K residue 52 type sequence N description BINDING SITE FOR RESIDUE HEM K 500 source : BC2 13) chain K residue 59 type sequence W description BINDING SITE FOR RESIDUE HEM K 500 source : BC2 14) chain K residue 67 type sequence Y description BINDING SITE FOR RESIDUE HEM K 500 source : BC2 15) chain K residue 68 type sequence L description BINDING SITE FOR RESIDUE HEM K 500 source : BC2 16) chain K residue 78 type sequence T description BINDING SITE FOR RESIDUE HEM K 500 source : BC2 17) chain K residue 79 type sequence K description BINDING SITE FOR RESIDUE HEM K 500 source : BC2 18) chain K residue 80 type sequence M description BINDING SITE FOR RESIDUE HEM K 500 source : BC2 19) chain K residue 81 type sequence I description BINDING SITE FOR RESIDUE HEM K 500 source : BC2 20) chain K residue 82 type sequence F description BINDING SITE FOR RESIDUE HEM K 500 source : BC2 21) chain K residue 99 type MOD_RES sequence K description N6-acetyllysine => ECO:0000250|UniProtKB:P62897 source Swiss-Prot : SWS_FT_FI8 22) chain K residue 1 type MOD_RES sequence G description N-acetylglycine => ECO:0000269|PubMed:5933874 source Swiss-Prot : SWS_FT_FI3 23) chain K residue 48 type MOD_RES sequence Y description Phosphotyrosine => ECO:0000269|PubMed:16866357 source Swiss-Prot : SWS_FT_FI4 24) chain K residue 55 type MOD_RES sequence K description N6-succinyllysine => ECO:0000250|UniProtKB:P62897 source Swiss-Prot : SWS_FT_FI5 25) chain K residue 72 type MOD_RES sequence K description N6-succinyllysine; alternate => ECO:0000250|UniProtKB:P62897 source Swiss-Prot : SWS_FT_FI6 26) chain K residue 97 type MOD_RES sequence Y description Phosphotyrosine => ECO:0000269|PubMed:18471988 source Swiss-Prot : SWS_FT_FI7 27) chain K residue 14 type BINDING sequence C description covalent source Swiss-Prot : SWS_FT_FI1 28) chain K residue 17 type BINDING sequence C description covalent source Swiss-Prot : SWS_FT_FI1 29) chain K residue 18 type BINDING sequence H description axial binding residue source Swiss-Prot : SWS_FT_FI2 30) chain K residue 80 type BINDING sequence M description axial binding residue source Swiss-Prot : SWS_FT_FI2

Display surface Download Links