eF-site ID 3j2t-H PDB Code 3j2t Chain H click to enlarge Title An improved model of the human apoptosome Classification APOPTOSIS Compound Apoptotic protease-activating factor 1 Source ORGANISM_COMMON: bovine; ORGANISM_SCIENTIFIC: Bos taurus; Sequence H:  GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKT GQAPGFSYTDANKNKGITWGEETLMEYLENPKKYIPGTKM IFAGIKKKGEREDLIAYLKKATNE Description (1)  Apoptotic protease-activating factor 1, Cytochrome c Functional site 1) chain H residue 13 type sequence K description BINDING SITE FOR RESIDUE HEM H 500 source : AC8 2) chain H residue 14 type sequence C description BINDING SITE FOR RESIDUE HEM H 500 source : AC8 3) chain H residue 16 type sequence Q description BINDING SITE FOR RESIDUE HEM H 500 source : AC8 4) chain H residue 17 type sequence C description BINDING SITE FOR RESIDUE HEM H 500 source : AC8 5) chain H residue 18 type sequence H description BINDING SITE FOR RESIDUE HEM H 500 source : AC8 6) chain H residue 28 type sequence T description BINDING SITE FOR RESIDUE HEM H 500 source : AC8 7) chain H residue 30 type sequence P description BINDING SITE FOR RESIDUE HEM H 500 source : AC8 8) chain H residue 40 type sequence T description BINDING SITE FOR RESIDUE HEM H 500 source : AC8 9) chain H residue 41 type sequence G description BINDING SITE FOR RESIDUE HEM H 500 source : AC8 10) chain H residue 48 type sequence Y description BINDING SITE FOR RESIDUE HEM H 500 source : AC8 11) chain H residue 49 type sequence T description BINDING SITE FOR RESIDUE HEM H 500 source : AC8 12) chain H residue 52 type sequence N description BINDING SITE FOR RESIDUE HEM H 500 source : AC8 13) chain H residue 59 type sequence W description BINDING SITE FOR RESIDUE HEM H 500 source : AC8 14) chain H residue 67 type sequence Y description BINDING SITE FOR RESIDUE HEM H 500 source : AC8 15) chain H residue 68 type sequence L description BINDING SITE FOR RESIDUE HEM H 500 source : AC8 16) chain H residue 78 type sequence T description BINDING SITE FOR RESIDUE HEM H 500 source : AC8 17) chain H residue 79 type sequence K description BINDING SITE FOR RESIDUE HEM H 500 source : AC8 18) chain H residue 80 type sequence M description BINDING SITE FOR RESIDUE HEM H 500 source : AC8 19) chain H residue 81 type sequence I description BINDING SITE FOR RESIDUE HEM H 500 source : AC8 20) chain H residue 82 type sequence F description BINDING SITE FOR RESIDUE HEM H 500 source : AC8 21) chain H residue 14 type BINDING sequence C description covalent source Swiss-Prot : SWS_FT_FI1 22) chain H residue 17 type BINDING sequence C description covalent source Swiss-Prot : SWS_FT_FI1 23) chain H residue 1 type MOD_RES sequence G description N-acetylglycine => ECO:0000269|PubMed:5933874 source Swiss-Prot : SWS_FT_FI3 24) chain H residue 48 type MOD_RES sequence Y description Phosphotyrosine => ECO:0000269|PubMed:16866357 source Swiss-Prot : SWS_FT_FI4 25) chain H residue 18 type BINDING sequence H description axial binding residue source Swiss-Prot : SWS_FT_FI2 26) chain H residue 80 type BINDING sequence M description axial binding residue source Swiss-Prot : SWS_FT_FI2 27) chain H residue 99 type MOD_RES sequence K description N6-acetyllysine => ECO:0000250|UniProtKB:P62897 source Swiss-Prot : SWS_FT_FI8 28) chain H residue 55 type MOD_RES sequence K description N6-succinyllysine => ECO:0000250|UniProtKB:P62897 source Swiss-Prot : SWS_FT_FI5 29) chain H residue 72 type MOD_RES sequence K description N6-succinyllysine; alternate => ECO:0000250|UniProtKB:P62897 source Swiss-Prot : SWS_FT_FI6 30) chain H residue 97 type MOD_RES sequence Y description Phosphotyrosine => ECO:0000269|PubMed:18471988 source Swiss-Prot : SWS_FT_FI7

Display surface Download Links