eF-site ID 3isv-A PDB Code 3isv Chain A click to enlarge Title Crystal structure of glutamate racemase from Listeria monocytogenes in complex with acetate ion Classification ISOMERASE Compound Glutamate racemase Source Listeria monocytogenes (MURI_LISMO) Sequence A:  AXKQAIGFIDSGVGGLTVVREVLKQLPHEQVYYLGDTARC PYGPRDKEEVAKFTWEXTNFLVDRGIKXLVIACNTATAAA LYDIREKLDIPVIGVIQPGSRAALKATRNNKIGVLGTLGT VESXAYPTALKGLNRRVEVDSLACPKFVSVVESGEYKSAI AKKVVAESLLPLKSTKIDTVILGCTHYPLLKPIIENFXGD GVAVINSGEETASEVSALLDYHNLLDATDEEEHRFFTTGS TQIFKDIAKDWLNXPDXTVEHIKLG Description Functional site 1) chain A residue 10 type sequence S description BINDING SITE FOR RESIDUE ACT A 267 source : AC1 2) chain A residue 40 type sequence P description BINDING SITE FOR RESIDUE ACT A 267 source : AC1 3) chain A residue 41 type sequence Y description BINDING SITE FOR RESIDUE ACT A 267 source : AC1 4) chain A residue 42 type sequence G description BINDING SITE FOR RESIDUE ACT A 267 source : AC1 5) chain A residue 147 type sequence V description BINDING SITE FOR RESIDUE ACT A 267 source : AC1 6) chain A residue 183 type sequence C description BINDING SITE FOR RESIDUE ACT A 267 source : AC1 7) chain A residue 135 type sequence R description BINDING SITE FOR RESIDUE ACT A 268 source : AC2 8) chain A residue 2 type sequence K description BINDING SITE FOR RESIDUE CA A 269 source : AC3 9) chain A residue 137 type sequence E description BINDING SITE FOR RESIDUE CA A 270 source : AC4 10) chain A residue 74 type sequence T description BINDING SITE FOR RESIDUE CL A 271 source : AC5 11) chain A residue 116 type sequence T description BINDING SITE FOR RESIDUE CL A 271 source : AC5 12) chain A residue 119 type sequence T description BINDING SITE FOR RESIDUE CL A 271 source : AC5 13) chain A residue 116 type sequence T description BINDING SITE FOR RESIDUE CL A 272 source : AC6 14) chain A residue 117 type sequence L description BINDING SITE FOR RESIDUE CL A 272 source : AC6 15) chain A residue 69-77 type prosite sequence VIACNTATA description ASP_GLU_RACEMASE_1 Aspartate and glutamate racemases signature 1. VIaC.NTATA source prosite : PS00923 16) chain A residue 179-189 type prosite sequence VILGCTHYPLL description ASP_GLU_RACEMASE_2 Aspartate and glutamate racemases signature 2. VIlGCTHYPlL source prosite : PS00924 17) chain A residue 72 type ACT_SITE sequence C description Proton donor/acceptor => ECO:0000250|UniProtKB:O58403, ECO:0000255|HAMAP-Rule:MF_00258 source Swiss-Prot : SWS_FT_FI1 18) chain A residue 183 type ACT_SITE sequence C description Proton donor/acceptor => ECO:0000250|UniProtKB:O58403, ECO:0000255|HAMAP-Rule:MF_00258 source Swiss-Prot : SWS_FT_FI1 19) chain A residue 9 type BINDING sequence D description BINDING => ECO:0000250|UniProtKB:P22634, ECO:0000255|HAMAP-Rule:MF_00258 source Swiss-Prot : SWS_FT_FI2 20) chain A residue 73 type BINDING sequence N description BINDING => ECO:0000250|UniProtKB:P22634, ECO:0000255|HAMAP-Rule:MF_00258 source Swiss-Prot : SWS_FT_FI2 21) chain A residue 184 type BINDING sequence T description BINDING => ECO:0000250|UniProtKB:P22634, ECO:0000255|HAMAP-Rule:MF_00258 source Swiss-Prot : SWS_FT_FI2 22) chain A residue 41 type BINDING sequence Y description BINDING => ECO:0000250|UniProtKB:P22634, ECO:0000255|HAMAP-Rule:MF_00258, ECO:0007744|PDB:3IST source Swiss-Prot : SWS_FT_FI3

Display surface Download Links