eF-site ID 3inh-A PDB Code 3inh Chain A click to enlarge Title Bace1 with the aminohydantoin Compound R-58 Classification HYDROLASE Compound Beta-secretase 1 Source null (BACE1_HUMAN) Sequence A:  SFVEMVDNLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSN FAVGAAPHPFLHRYYQRQLSSTYRDLRKGVYVPYKWEGEL GTDLVSIPHGPNVTVRANIAAITESDKFFINGSNWEGILG LAYAEIARPDDSLEPFFDSLVKQTHVPNLFSLQLCGAGFL ASVGGSMIIGGIDHSLYTGSLWYTPIRREWYYEVIIVRVE INGQDLKMDCKEYNYDKSIVDSGTTNLRLPKKVFEAAVKS IKAASSTEKFPDGFWLGEQLVCWQAGTTPWNIFPVISLYL MGEVTNQSFRITILPQQYLRPCYKFAISQSSTGTVMGAVI MEGFYVVFDRARKRIGFAVSACHVHDEFRTAAVEGPFVTL DCGYNI Description Functional site 1) chain A residue 73 type sequence G description BINDING SITE FOR RESIDUE 569 A 1 source : AC1 2) chain A residue 74 type sequence Q description BINDING SITE FOR RESIDUE 569 A 1 source : AC1 3) chain A residue 75 type sequence G description BINDING SITE FOR RESIDUE 569 A 1 source : AC1 4) chain A residue 94 type sequence D description BINDING SITE FOR RESIDUE 569 A 1 source : AC1 5) chain A residue 97 type sequence S description BINDING SITE FOR RESIDUE 569 A 1 source : AC1 6) chain A residue 131 type sequence V description BINDING SITE FOR RESIDUE 569 A 1 source : AC1 7) chain A residue 138 type sequence W description BINDING SITE FOR RESIDUE 569 A 1 source : AC1 8) chain A residue 170 type sequence F description BINDING SITE FOR RESIDUE 569 A 1 source : AC1 9) chain A residue 172 type sequence I description BINDING SITE FOR RESIDUE 569 A 1 source : AC1 10) chain A residue 177 type sequence W description BINDING SITE FOR RESIDUE 569 A 1 source : AC1 11) chain A residue 180 type sequence I description BINDING SITE FOR RESIDUE 569 A 1 source : AC1 12) chain A residue 190 type sequence R description BINDING SITE FOR RESIDUE 569 A 1 source : AC1 13) chain A residue 290 type sequence D description BINDING SITE FOR RESIDUE 569 A 1 source : AC1 14) chain A residue 292 type sequence G description BINDING SITE FOR RESIDUE 569 A 1 source : AC1 15) chain A residue 293 type sequence T description BINDING SITE FOR RESIDUE 569 A 1 source : AC1 16) chain A residue 294 type sequence T description BINDING SITE FOR RESIDUE 569 A 1 source : AC1 17) chain A residue 94 type ACT_SITE sequence D description ACT_SITE => ECO:0000255|PROSITE-ProRule:PRU10094 source Swiss-Prot : SWS_FT_FI1 18) chain A residue 290 type ACT_SITE sequence D description ACT_SITE => ECO:0000255|PROSITE-ProRule:PRU10094 source Swiss-Prot : SWS_FT_FI1 19) chain A residue 127 type MOD_RES sequence K description N6-acetyllysine => ECO:0000269|PubMed:17425515, ECO:0000269|PubMed:19011241 source Swiss-Prot : SWS_FT_FI2 20) chain A residue 276 type MOD_RES sequence K description N6-acetyllysine => ECO:0000269|PubMed:17425515, ECO:0000269|PubMed:19011241 source Swiss-Prot : SWS_FT_FI2 21) chain A residue 280 type MOD_RES sequence K description N6-acetyllysine => ECO:0000269|PubMed:17425515, ECO:0000269|PubMed:19011241 source Swiss-Prot : SWS_FT_FI2 22) chain A residue 286 type MOD_RES sequence K description N6-acetyllysine => ECO:0000269|PubMed:17425515, ECO:0000269|PubMed:19011241 source Swiss-Prot : SWS_FT_FI2 23) chain A residue 300 type MOD_RES sequence K description N6-acetyllysine => ECO:0000269|PubMed:17425515, ECO:0000269|PubMed:19011241 source Swiss-Prot : SWS_FT_FI2 24) chain A residue 301 type MOD_RES sequence K description N6-acetyllysine => ECO:0000269|PubMed:17425515, ECO:0000269|PubMed:19011241 source Swiss-Prot : SWS_FT_FI2 25) chain A residue 308 type MOD_RES sequence K description N6-acetyllysine => ECO:0000269|PubMed:17425515, ECO:0000269|PubMed:19011241 source Swiss-Prot : SWS_FT_FI2 26) chain A residue 154 type CARBOHYD sequence N description N-linked (GlcNAc...) asparagine => ECO:0000255 source Swiss-Prot : SWS_FT_FI3 27) chain A residue 173 type CARBOHYD sequence N description N-linked (GlcNAc...) asparagine => ECO:0000255 source Swiss-Prot : SWS_FT_FI3 28) chain A residue 355 type CARBOHYD sequence N description N-linked (GlcNAc...) asparagine => ECO:0000255 source Swiss-Prot : SWS_FT_FI3 29) chain A residue 91-102 type prosite sequence ILVDTGSSNFAV description ASP_PROTEASE Eukaryotic and viral aspartyl proteases active site. ILVDTGSSNFAV source prosite : PS00141

Display surface Download Links