eF-site ID 3ilk-A PDB Code 3ilk Chain A click to enlarge Title The structure of a probable methylase family protein from Haemophilus influenzae Rd KW20 Classification structural genomics, unknown function Compound Uncharacterized tRNA/rRNA methyltransferase HI0380 Source Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (Y380_HAEIN) Sequence A:  NAXLENIRIVLIETSHSGNIGSAARAXKTXGLTQLCLVSP KSVDEQSYALSAGAENIVKNARVVDSFDEAVDDCSLVIGT SARLRHLQNTLIEPRECAEKVVAYKGKIAIVFGRERIGLT NEELLKCHYHLNIPANPDYSSLNLAXAVQLVSYELRXAFL VQNNKKNSLSLEKNYPTTDQLAYFFDYTERIYQSLGFIQN QGVXRKLKRLYYRAKLEKNELNILNGXLSAVEKRIDLTK Description (1)  Uncharacterized tRNA/rRNA methyltransferase HI0380 (E.C.2.1.1.-) Functional site 1) chain A residue 78 type sequence T description BINDING SITE FOR RESIDUE EDO A 242 source : AC1 2) chain A residue 111 type sequence G description BINDING SITE FOR RESIDUE EDO A 242 source : AC1 3) chain A residue 140 type sequence L description BINDING SITE FOR RESIDUE EDO A 242 source : AC1 4) chain A residue 79 type sequence S description BINDING SITE FOR RESIDUE EDO A 243 source : AC2 5) chain A residue 129 type sequence L description BINDING SITE FOR RESIDUE EDO A 243 source : AC2 6) chain A residue 130 type sequence N description BINDING SITE FOR RESIDUE EDO A 243 source : AC2 7) chain A residue 131 type sequence I description BINDING SITE FOR RESIDUE EDO A 243 source : AC2 8) chain A residue 23 type sequence R description BINDING SITE FOR RESIDUE SO4 B 246 source : AC7 9) chain A residue 78 type BINDING sequence T description BINDING => ECO:0000250|UniProtKB:P0AE01 source Swiss-Prot : SWS_FT_FI1 10) chain A residue 111 type BINDING sequence G description BINDING => ECO:0000250|UniProtKB:P0AE01 source Swiss-Prot : SWS_FT_FI1 11) chain A residue 131 type BINDING sequence I description BINDING => ECO:0000250|UniProtKB:P0AE01 source Swiss-Prot : SWS_FT_FI1 12) chain A residue 138 type BINDING sequence S description BINDING => ECO:0000250|UniProtKB:P0AE01 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links