eF-site ID 3ilk-A
PDB Code 3ilk
Chain A

click to enlarge
Title The structure of a probable methylase family protein from Haemophilus influenzae Rd KW20
Classification structural genomics, unknown function
Compound Uncharacterized tRNA/rRNA methyltransferase HI0380
Source Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (Y380_HAEIN)
Sequence A:  NAXLENIRIVLIETSHSGNIGSAARAXKTXGLTQLCLVSP
KSVDEQSYALSAGAENIVKNARVVDSFDEAVDDCSLVIGT
SARLRHLQNTLIEPRECAEKVVAYKGKIAIVFGRERIGLT
NEELLKCHYHLNIPANPDYSSLNLAXAVQLVSYELRXAFL
VQNNKKNSLSLEKNYPTTDQLAYFFDYTERIYQSLGFIQN
QGVXRKLKRLYYRAKLEKNELNILNGXLSAVEKRIDLTK
Description (1)  Uncharacterized tRNA/rRNA methyltransferase HI0380 (E.C.2.1.1.-)


Functional site

1) chain A
residue 78
type
ligand
sequence T
description BINDING SITE FOR RESIDUE EDO A 242
source : AC1

2) chain A
residue 111
type
ligand
sequence G
description BINDING SITE FOR RESIDUE EDO A 242
source : AC1

3) chain A
residue 140
type
ligand
sequence L
description BINDING SITE FOR RESIDUE EDO A 242
source : AC1

4) chain A
residue 79
type
ligand
sequence S
description BINDING SITE FOR RESIDUE EDO A 243
source : AC2

5) chain A
residue 129
type
ligand
sequence L
description BINDING SITE FOR RESIDUE EDO A 243
source : AC2

6) chain A
residue 130
type
ligand
sequence N
description BINDING SITE FOR RESIDUE EDO A 243
source : AC2

7) chain A
residue 131
type
ligand
sequence I
description BINDING SITE FOR RESIDUE EDO A 243
source : AC2

8) chain A
residue 23
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SO4 B 246
source : AC7

9) chain A
residue 20
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence S
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_3ilk_B_244

10) chain A
residue 23
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence R
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_3ilk_B_244

11) chain A
residue 141
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence N
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_3ilk_B_244

12) chain A
residue 143
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence A
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_3ilk_B_244

13) chain A
residue 78-80
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence TSA
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_3ilk_A_243

14) chain A
residue 129-131
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence LNI
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_3ilk_A_243

15) chain A
residue 140
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence L
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_3ilk_A_243

16) chain A
residue 145
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence A
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_3ilk_A_243

17) chain A
residue 78
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence T
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_3ilk_A_242

18) chain A
residue 110-113
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence FGRE
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_3ilk_A_242

19) chain A
residue 140-142
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence LNL
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_3ilk_A_242

20) chain A
residue 145
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence A
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_3ilk_A_242


Display surface

Download
Links