eF-site ID 3ifu-A PDB Code 3ifu Chain A click to enlarge Title The Crystal Structure of Porcine Reproductive and Respiratory Syndrome Virus (PRRSV) Leader Protease Nsp1 Classification TRANSCRIPTION Compound Non-structural protein Source Porcine reproductive and respiratory syndrome virus (PRRSV) (B6VGX5_PRRSV) Sequence A:  DRCTCTPNARVFVAEGQVYCTRCLSARSLLPLNLQVPELG VLGLFYRPEEPLRWTLPRAFPTVECSPAGACWLSAIFPIA RMTSGNLNFQQRMVRVAAEIYRAGQLTPTVLKTLQVYERG CRWYPIVGPVPGVGVYANSLHVSDKPFPGATHVLTNLPLP QRPKPEDFCPFECAM Description Functional site 1) chain A residue 70 type sequence C description BINDING SITE FOR RESIDUE ZN A 181 source : AC1 2) chain A residue 76 type sequence C description BINDING SITE FOR RESIDUE ZN A 181 source : AC1 3) chain A residue 146 type sequence H description BINDING SITE FOR RESIDUE ZN A 181 source : AC1 4) chain A residue 180 type sequence M description BINDING SITE FOR RESIDUE ZN A 181 source : AC1 5) chain A residue 8 type sequence C description BINDING SITE FOR RESIDUE ZN A 182 source : AC2 6) chain A residue 10 type sequence C description BINDING SITE FOR RESIDUE ZN A 182 source : AC2 7) chain A residue 25 type sequence C description BINDING SITE FOR RESIDUE ZN A 182 source : AC2 8) chain A residue 28 type sequence C description BINDING SITE FOR RESIDUE ZN A 182 source : AC2

Display surface Download Links