eF-site ID 3i3t-A PDB Code 3i3t Chain A click to enlarge Title Crystal structure of covalent ubiquitin-USP21 complex Classification HYDROLASE Compound Ubiquitin carboxyl-terminal hydrolase 21 Source Homo sapiens (Human) (UBIQ_HUMAN) Sequence A:  HVGLRNLGNTCFLNAVLQCLSSTRPLRDFCLRRDFRQEVQ ELTEAFADVIGALWHPDSCEAVNPTRFRAVFQKYVPSFSG YSQQDAQEFLKLLMERLHLEINRRLSDDDRANLMWKRYLE REDSKIVDLFVGQLKSCLKCQACGYRSTTFEVFCDLSLPI PKVSLRDCFNLFTKEEELESENAPVCDRCRQKTRSTKKLT VQRFPRILVLHLNRFSASRGSIKKSSVGVDFPLQRLSLGD FASSPVYQLYALCNHSGSVHYGHYTALCRCQTGWHVYNDS RVSPVSENQVASSEGYVLFYQLM Description Functional site 1) chain A residue 384 type sequence C description BINDING SITE FOR RESIDUE ZN A 700 source : AC1 2) chain A residue 387 type sequence C description BINDING SITE FOR RESIDUE ZN A 700 source : AC1 3) chain A residue 437 type sequence C description BINDING SITE FOR RESIDUE ZN A 700 source : AC1 4) chain A residue 440 type sequence C description BINDING SITE FOR RESIDUE ZN A 700 source : AC1 5) chain A residue 219 type sequence N description BINDING SITE FOR RESIDUE NEH B 76 source : AC5 6) chain A residue 221 type sequence C description BINDING SITE FOR RESIDUE NEH B 76 source : AC5 7) chain A residue 517 type sequence G description BINDING SITE FOR RESIDUE NEH B 76 source : AC5 8) chain A residue 213-228 type prosite sequence GLRNLGNTCFLNAVLQ description USP_1 Ubiquitin specific protease (USP) domain signature 1. GLrnlGNtCFLNAvLQ source prosite : PS00972 9) chain A residue 502-519 type prosite sequence YQLYALCNHSGSVHYGHY description USP_2 Ubiquitin specific protease (USP) domain signature 2. YqLyALcnHsGsvhy..GHY source prosite : PS00973

Display surface Download Links