eF-site ID 3hyg-A PDB Code 3hyg Chain A click to enlarge Title Crystal Structure of the Catalytic Domain of ADAMTS-5 in Complex with an Amino-2-indanol compound Classification HYDROLASE Compound A disintegrin and metalloproteinase with thrombospondin motifs 5 Source null (ATS5_HUMAN) Sequence A:  SRARQVELLLVADASMARKYGRGLQHYLLTLASIANRLYS HASIENHIRLAVVKVVVLGDKDKSLEVSKNAATTLKNFCK WQHQHNQLGDDHEEHYDAAILFTREDLCGHHSCDTLGMAD VGTICSPERSCAVIEDDGLHAAFTVAHEIGHLLGLSHDDS KFCEETFGSTEDKRLMSSILTSIDASKPWSKCTSATITEF LDDGHGNCLLDLPRKQI Description Functional site 1) chain A residue 410 type sequence H description BINDING SITE FOR RESIDUE ZN A 901 source : AC1 2) chain A residue 414 type sequence H description BINDING SITE FOR RESIDUE ZN A 901 source : AC1 3) chain A residue 420 type sequence H description BINDING SITE FOR RESIDUE ZN A 901 source : AC1 4) chain A residue 270 type sequence E description BINDING SITE FOR RESIDUE CA A 902 source : AC2 5) chain A residue 353 type sequence D description BINDING SITE FOR RESIDUE CA A 902 source : AC2 6) chain A residue 360 type sequence D description BINDING SITE FOR RESIDUE CA A 902 source : AC2 7) chain A residue 471 type sequence C description BINDING SITE FOR RESIDUE CA A 902 source : AC2 8) chain A residue 474 type sequence D description BINDING SITE FOR RESIDUE CA A 902 source : AC2 9) chain A residue 270 type sequence E description BINDING SITE FOR RESIDUE CA A 903 source : AC3 10) chain A residue 353 type sequence D description BINDING SITE FOR RESIDUE CA A 903 source : AC3 11) chain A residue 474 type sequence D description BINDING SITE FOR RESIDUE CA A 903 source : AC3 12) chain A residue 369 type sequence D description BINDING SITE FOR RESIDUE CA A 904 source : AC4 13) chain A residue 370 type sequence L description BINDING SITE FOR RESIDUE CA A 904 source : AC4 14) chain A residue 376 type sequence C description BINDING SITE FOR RESIDUE CA A 904 source : AC4 15) chain A residue 378 type sequence T description BINDING SITE FOR RESIDUE CA A 904 source : AC4 16) chain A residue 398 type sequence E description BINDING SITE FOR RESIDUE CA A 904 source : AC4 17) chain A residue 377 type sequence D description BINDING SITE FOR RESIDUE 099 A 801 source : AC5 18) chain A residue 378 type sequence T description BINDING SITE FOR RESIDUE 099 A 801 source : AC5 19) chain A residue 379 type sequence L description BINDING SITE FOR RESIDUE 099 A 801 source : AC5 20) chain A residue 380 type sequence G description BINDING SITE FOR RESIDUE 099 A 801 source : AC5 21) chain A residue 407 type sequence T description BINDING SITE FOR RESIDUE 099 A 801 source : AC5 22) chain A residue 410 type sequence H description BINDING SITE FOR RESIDUE 099 A 801 source : AC5 23) chain A residue 411 type sequence E description BINDING SITE FOR RESIDUE 099 A 801 source : AC5 24) chain A residue 414 type sequence H description BINDING SITE FOR RESIDUE 099 A 801 source : AC5 25) chain A residue 420 type sequence H description BINDING SITE FOR RESIDUE 099 A 801 source : AC5 26) chain A residue 438 type sequence L description BINDING SITE FOR RESIDUE 099 A 801 source : AC5 27) chain A residue 440 type sequence S description BINDING SITE FOR RESIDUE 099 A 801 source : AC5 28) chain A residue 441 type sequence S description BINDING SITE FOR RESIDUE 099 A 801 source : AC5 29) chain A residue 442 type sequence I description BINDING SITE FOR RESIDUE 099 A 801 source : AC5 30) chain A residue 443 type sequence L description BINDING SITE FOR RESIDUE 099 A 801 source : AC5 31) chain A residue 411 type ACT_SITE sequence E description ACT_SITE => ECO:0000255|PROSITE-ProRule:PRU00276, ECO:0000255|PROSITE-ProRule:PRU10095, ECO:0000269|PubMed:18042673 source Swiss-Prot : SWS_FT_FI1 32) chain A residue 410 type BINDING sequence H description BINDING => ECO:0000269|PubMed:18042673 source Swiss-Prot : SWS_FT_FI2 33) chain A residue 414 type BINDING sequence H description BINDING => ECO:0000269|PubMed:18042673 source Swiss-Prot : SWS_FT_FI2 34) chain A residue 420 type BINDING sequence H description BINDING => ECO:0000269|PubMed:18042673 source Swiss-Prot : SWS_FT_FI2 35) chain A residue 407-416 type prosite sequence TVAHEIGHLL description ZINC_PROTEASE Neutral zinc metallopeptidases, zinc-binding region signature. TVAHEIGHLL source prosite : PS00142

Display surface Download Links