eF-site ID 3hdf-AB PDB Code 3hdf Chain A, B click to enlarge Title Crystal structure of truncated endolysin R21 from phage 21 Classification HYDROLASE Compound Lysozyme Source Enterobacteria phage P21 (Bacteriophage 21) (Bacteriophage P21) (LYS_BPP21) Sequence A:  DGLEGVSYIPYKDIVGVWTVCHGHTGKDIMLGKTYTKAEC KALLNKDLATVARQINPYIKVDIPETMRGALYSFVYNVGA GNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGLMT RREIEREICLWGQ B:  DGLEGVSYIPYKDIVGVWTVCHGHTGKDIMLGKTYTKAEC KALLNKDLATVARQINPYIKVDIPETMRGALYSFVYNVGA GNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGLMT RREIEREICLWG Description (1)  Lysozyme (E.C.3.2.1.17) Functional site 1) chain A residue 68 type sequence K description BINDING SITE FOR RESIDUE NO3 A 1210 source : AC1 2) chain A residue 69 type sequence A description BINDING SITE FOR RESIDUE NO3 A 1210 source : AC1 3) chain A residue 72 type sequence K description BINDING SITE FOR RESIDUE NO3 A 1210 source : AC1 4) chain B residue 121 type sequence R description BINDING SITE FOR RESIDUE NO3 A 1210 source : AC1 5) chain A residue 41 type sequence P description BINDING SITE FOR RESIDUE GOL A 1001 source : AC2 6) chain A residue 42 type sequence Y description BINDING SITE FOR RESIDUE GOL A 1001 source : AC2 7) chain B residue 40 type sequence I description BINDING SITE FOR RESIDUE GOL A 1001 source : AC2 8) chain B residue 41 type sequence P description BINDING SITE FOR RESIDUE GOL A 1001 source : AC2 9) chain A residue 86 type sequence I description BINDING SITE FOR RESIDUE GOL A 1002 source : AC3 10) chain A residue 89 type sequence Y description BINDING SITE FOR RESIDUE GOL A 1002 source : AC3 11) chain A residue 111 type sequence A description BINDING SITE FOR RESIDUE GOL A 1002 source : AC3 12) chain A residue 117 type sequence S description BINDING SITE FOR RESIDUE GOL A 1002 source : AC3 13) chain A residue 114 type sequence F description BINDING SITE FOR RESIDUE GOL A 1003 source : AC4 14) chain B residue 75 type sequence L description BINDING SITE FOR RESIDUE GOL A 1003 source : AC4 15) chain B residue 79 type sequence L description BINDING SITE FOR RESIDUE GOL A 1003 source : AC4 16) chain B residue 104 type sequence S description BINDING SITE FOR RESIDUE GOL A 1003 source : AC4 17) chain B residue 148 type sequence G description BINDING SITE FOR RESIDUE GOL A 1003 source : AC4 18) chain B residue 149 type sequence L description BINDING SITE FOR RESIDUE GOL A 1003 source : AC4 19) chain B residue 150 type sequence M description BINDING SITE FOR RESIDUE GOL A 1003 source : AC4 20) chain A residue 122 type sequence K description BINDING SITE FOR RESIDUE GOL A 1004 source : AC5 21) chain A residue 134 type sequence Q description BINDING SITE FOR RESIDUE GOL A 1004 source : AC5 22) chain A residue 137 type sequence R description BINDING SITE FOR RESIDUE GOL A 1004 source : AC5 23) chain B residue 73 type sequence A description BINDING SITE FOR RESIDUE GOL A 1004 source : AC5 24) chain B residue 76 type sequence N description BINDING SITE FOR RESIDUE GOL A 1004 source : AC5 25) chain A residue 105 type sequence F description BINDING SITE FOR RESIDUE GOL A 1006 source : AC6 26) chain A residue 115 type sequence R description BINDING SITE FOR RESIDUE GOL A 1006 source : AC6 27) chain A residue 134 type sequence Q description BINDING SITE FOR RESIDUE GOL A 1006 source : AC6 28) chain A residue 138 type sequence W description BINDING SITE FOR RESIDUE GOL A 1006 source : AC6 29) chain A residue 152 type sequence R description BINDING SITE FOR RESIDUE GOL A 1006 source : AC6 30) chain B residue 76 type sequence N description BINDING SITE FOR RESIDUE GOL A 1006 source : AC6 31) chain B residue 53 type sequence H description BINDING SITE FOR RESIDUE GOL A 1007 source : AC7 32) chain B residue 146 type sequence W description BINDING SITE FOR RESIDUE GOL A 1007 source : AC7 33) chain B residue 147 type sequence K description BINDING SITE FOR RESIDUE GOL A 1007 source : AC7 34) chain B residue 148 type sequence G description BINDING SITE FOR RESIDUE GOL A 1007 source : AC7 35) chain A residue 79 type sequence L description BINDING SITE FOR RESIDUE NO3 B 1202 source : AC8 36) chain A residue 104 type sequence S description BINDING SITE FOR RESIDUE NO3 B 1202 source : AC8 37) chain A residue 148 type sequence G description BINDING SITE FOR RESIDUE NO3 B 1202 source : AC8 38) chain A residue 149 type sequence L description BINDING SITE FOR RESIDUE NO3 B 1202 source : AC8 39) chain A residue 150 type sequence M description BINDING SITE FOR RESIDUE NO3 B 1202 source : AC8 40) chain B residue 114 type sequence F description BINDING SITE FOR RESIDUE NO3 B 1202 source : AC8 41) chain B residue 38 type sequence S description BINDING SITE FOR RESIDUE NO3 B 1201 source : AC9 42) chain B residue 39 type sequence Y description BINDING SITE FOR RESIDUE NO3 B 1201 source : AC9 43) chain B residue 40 type sequence I description BINDING SITE FOR RESIDUE NO3 B 1201 source : AC9 44) chain B residue 57 type sequence G description BINDING SITE FOR RESIDUE NO3 B 1203 source : BC1 45) chain B residue 58 type sequence K description BINDING SITE FOR RESIDUE NO3 B 1203 source : BC1 46) chain B residue 60 type sequence I description BINDING SITE FOR RESIDUE NO3 B 1203 source : BC1 47) chain A residue 34 type sequence L description BINDING SITE FOR RESIDUE NO3 B 1205 source : BC2 48) chain A residue 37 type sequence V description BINDING SITE FOR RESIDUE NO3 B 1205 source : BC2 49) chain A residue 39 type sequence Y description BINDING SITE FOR RESIDUE NO3 B 1205 source : BC2 50) chain A residue 53 type sequence H description BINDING SITE FOR RESIDUE NO3 B 1205 source : BC2 51) chain A residue 68 type sequence K description BINDING SITE FOR RESIDUE NO3 B 1205 source : BC2 52) chain A residue 71 type sequence C description BINDING SITE FOR RESIDUE NO3 B 1205 source : BC2 53) chain A residue 72 type sequence K description BINDING SITE FOR RESIDUE NO3 B 1205 source : BC2 54) chain B residue 34 type sequence L description BINDING SITE FOR RESIDUE NO3 B 1206 source : BC3 55) chain B residue 39 type sequence Y description BINDING SITE FOR RESIDUE NO3 B 1206 source : BC3 56) chain B residue 53 type sequence H description BINDING SITE FOR RESIDUE NO3 B 1206 source : BC3 57) chain B residue 68 type sequence K description BINDING SITE FOR RESIDUE NO3 B 1206 source : BC3 58) chain B residue 71 type sequence C description BINDING SITE FOR RESIDUE NO3 B 1206 source : BC3 59) chain B residue 72 type sequence K description BINDING SITE FOR RESIDUE NO3 B 1206 source : BC3 60) chain A residue 76 type sequence N description BINDING SITE FOR RESIDUE NO3 B 1207 source : BC4 61) chain B residue 105 type sequence F description BINDING SITE FOR RESIDUE NO3 B 1207 source : BC4 62) chain B residue 115 type sequence R description BINDING SITE FOR RESIDUE NO3 B 1207 source : BC4 63) chain B residue 134 type sequence Q description BINDING SITE FOR RESIDUE NO3 B 1207 source : BC4 64) chain B residue 135 type sequence L description BINDING SITE FOR RESIDUE NO3 B 1207 source : BC4 65) chain B residue 138 type sequence W description BINDING SITE FOR RESIDUE NO3 B 1207 source : BC4 66) chain B residue 152 type sequence R description BINDING SITE FOR RESIDUE NO3 B 1207 source : BC4 67) chain A residue 38 type sequence S description BINDING SITE FOR RESIDUE NO3 B 1208 source : BC5 68) chain A residue 39 type sequence Y description BINDING SITE FOR RESIDUE NO3 B 1208 source : BC5 69) chain A residue 40 type sequence I description BINDING SITE FOR RESIDUE NO3 B 1208 source : BC5 70) chain A residue 121 type sequence R description BINDING SITE FOR RESIDUE NO3 B 1209 source : BC6 71) chain B residue 68 type sequence K description BINDING SITE FOR RESIDUE NO3 B 1209 source : BC6 72) chain B residue 69 type sequence A description BINDING SITE FOR RESIDUE NO3 B 1209 source : BC6 73) chain B residue 72 type sequence K description BINDING SITE FOR RESIDUE NO3 B 1209 source : BC6 74) chain A residue 57 type sequence G description BINDING SITE FOR RESIDUE NO3 B 1211 source : BC7 75) chain A residue 58 type sequence K description BINDING SITE FOR RESIDUE NO3 B 1211 source : BC7 76) chain A residue 60 type sequence I description BINDING SITE FOR RESIDUE NO3 B 1211 source : BC7 77) chain A residue 35 type ACT_SITE sequence E description Proton donor/acceptor => ECO:0000255|HAMAP-Rule:MF_04136, ECO:0000305|PubMed:19881499 source Swiss-Prot : SWS_FT_FI1 78) chain A residue 44 type ACT_SITE sequence D description Proton donor/acceptor => ECO:0000255|HAMAP-Rule:MF_04136, ECO:0000305|PubMed:19881499 source Swiss-Prot : SWS_FT_FI1 79) chain B residue 35 type ACT_SITE sequence E description Proton donor/acceptor => ECO:0000255|HAMAP-Rule:MF_04136, ECO:0000305|PubMed:19881499 source Swiss-Prot : SWS_FT_FI1 80) chain B residue 44 type ACT_SITE sequence D description Proton donor/acceptor => ECO:0000255|HAMAP-Rule:MF_04136, ECO:0000305|PubMed:19881499 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links