eF-site ID 3hdf-A PDB Code 3hdf Chain A click to enlarge Title Crystal structure of truncated endolysin R21 from phage 21 Classification HYDROLASE Compound Lysozyme Source Enterobacteria phage P21 (Bacteriophage 21) (Bacteriophage P21) (LYS_BPP21) Sequence A:  DGLEGVSYIPYKDIVGVWTVCHGHTGKDIMLGKTYTKAEC KALLNKDLATVARQINPYIKVDIPETMRGALYSFVYNVGA GNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGLMT RREIEREICLWGQ Description (1)  Lysozyme (E.C.3.2.1.17) Functional site 1) chain A residue 68 type sequence K description BINDING SITE FOR RESIDUE NO3 A 1210 source : AC1 2) chain A residue 69 type sequence A description BINDING SITE FOR RESIDUE NO3 A 1210 source : AC1 3) chain A residue 72 type sequence K description BINDING SITE FOR RESIDUE NO3 A 1210 source : AC1 4) chain A residue 41 type sequence P description BINDING SITE FOR RESIDUE GOL A 1001 source : AC2 5) chain A residue 42 type sequence Y description BINDING SITE FOR RESIDUE GOL A 1001 source : AC2 6) chain A residue 86 type sequence I description BINDING SITE FOR RESIDUE GOL A 1002 source : AC3 7) chain A residue 89 type sequence Y description BINDING SITE FOR RESIDUE GOL A 1002 source : AC3 8) chain A residue 111 type sequence A description BINDING SITE FOR RESIDUE GOL A 1002 source : AC3 9) chain A residue 117 type sequence S description BINDING SITE FOR RESIDUE GOL A 1002 source : AC3 10) chain A residue 114 type sequence F description BINDING SITE FOR RESIDUE GOL A 1003 source : AC4 11) chain A residue 122 type sequence K description BINDING SITE FOR RESIDUE GOL A 1004 source : AC5 12) chain A residue 134 type sequence Q description BINDING SITE FOR RESIDUE GOL A 1004 source : AC5 13) chain A residue 137 type sequence R description BINDING SITE FOR RESIDUE GOL A 1004 source : AC5 14) chain A residue 105 type sequence F description BINDING SITE FOR RESIDUE GOL A 1006 source : AC6 15) chain A residue 115 type sequence R description BINDING SITE FOR RESIDUE GOL A 1006 source : AC6 16) chain A residue 134 type sequence Q description BINDING SITE FOR RESIDUE GOL A 1006 source : AC6 17) chain A residue 138 type sequence W description BINDING SITE FOR RESIDUE GOL A 1006 source : AC6 18) chain A residue 152 type sequence R description BINDING SITE FOR RESIDUE GOL A 1006 source : AC6 19) chain A residue 79 type sequence L description BINDING SITE FOR RESIDUE NO3 B 1202 source : AC8 20) chain A residue 104 type sequence S description BINDING SITE FOR RESIDUE NO3 B 1202 source : AC8 21) chain A residue 148 type sequence G description BINDING SITE FOR RESIDUE NO3 B 1202 source : AC8 22) chain A residue 149 type sequence L description BINDING SITE FOR RESIDUE NO3 B 1202 source : AC8 23) chain A residue 150 type sequence M description BINDING SITE FOR RESIDUE NO3 B 1202 source : AC8 24) chain A residue 34 type sequence L description BINDING SITE FOR RESIDUE NO3 B 1205 source : BC2 25) chain A residue 37 type sequence V description BINDING SITE FOR RESIDUE NO3 B 1205 source : BC2 26) chain A residue 39 type sequence Y description BINDING SITE FOR RESIDUE NO3 B 1205 source : BC2 27) chain A residue 53 type sequence H description BINDING SITE FOR RESIDUE NO3 B 1205 source : BC2 28) chain A residue 68 type sequence K description BINDING SITE FOR RESIDUE NO3 B 1205 source : BC2 29) chain A residue 71 type sequence C description BINDING SITE FOR RESIDUE NO3 B 1205 source : BC2 30) chain A residue 72 type sequence K description BINDING SITE FOR RESIDUE NO3 B 1205 source : BC2 31) chain A residue 76 type sequence N description BINDING SITE FOR RESIDUE NO3 B 1207 source : BC4 32) chain A residue 38 type sequence S description BINDING SITE FOR RESIDUE NO3 B 1208 source : BC5 33) chain A residue 39 type sequence Y description BINDING SITE FOR RESIDUE NO3 B 1208 source : BC5 34) chain A residue 40 type sequence I description BINDING SITE FOR RESIDUE NO3 B 1208 source : BC5 35) chain A residue 121 type sequence R description BINDING SITE FOR RESIDUE NO3 B 1209 source : BC6 36) chain A residue 57 type sequence G description BINDING SITE FOR RESIDUE NO3 B 1211 source : BC7 37) chain A residue 58 type sequence K description BINDING SITE FOR RESIDUE NO3 B 1211 source : BC7 38) chain A residue 60 type sequence I description BINDING SITE FOR RESIDUE NO3 B 1211 source : BC7 39) chain A residue 35 type ACT_SITE sequence E description Proton donor/acceptor => ECO:0000255|HAMAP-Rule:MF_04136, ECO:0000305|PubMed:19881499 source Swiss-Prot : SWS_FT_FI1 40) chain A residue 44 type ACT_SITE sequence D description Proton donor/acceptor => ECO:0000255|HAMAP-Rule:MF_04136, ECO:0000305|PubMed:19881499 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links