eF-site ID 3h0m-S
PDB Code 3h0m
Chain S

click to enlarge
Title Structure of trna-dependent amidotransferase gatcab from aquifex aeolicus
Classification LIGASE
Compound Glutamyl-tRNA(Gln) amidotransferase subunit A
Source Aquifex aeolicus (GATC_AQUAE)
Sequence S:  MLWKKSLSELRELLKRGEVSPKEVVESFYDRYNQTEEKVK
AYITPLYGKALKQAESLKERELPLFGIPIAVKDNILVEGE
KTTCASKILENFVAPYDATVIERLKKAGALIVGKTNLDEF
AMGSSTEYSAFFPTKNPWDLERVPGGSSGGSAASVAVLSA
PVSLGSDTGGSIRQPASFCGVIGIKPTYGRVSRYGLVAFA
SSLDQIGVFGRRTEDVALVLEVISGWDEKDSTSAKVPVPE
WSEEVKKEVKGLKIGLPKEFFEYELQPQVKEAFENFIKEL
EKEGFEIKEVSLPHVKYSIPTYYIIAPSEASSNLARYDGV
RYGYRAKEYKDIFEMYARTRDEGFGPEVKRRIMLGTFALS
AGYYDAYYLKAQKVRRLITNDFLKAFEEVDVIASPTTPTL
PFKFGERLENPIEMYLSDILTVPANLAGLPAISIPIAWKD
GLPVGGQLIGKHWDETTLLQISYLWEQKFKHYEKIPLT
Description (1)  Glutamyl-tRNA(Gln) amidotransferase subunit A (E.C.6.3.5.-), Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B (E.C.6.3.5.-), Glutamyl-tRNA(Gln) amidotransferase subunit C (E.C.6.3.5.-)


Functional site

1) chain S
residue 121
type
ligand
sequence A
description BINDING SITE FOR RESIDUE GLN S 907
source : AC7

2) chain S
residue 122
type
ligand
sequence M
description BINDING SITE FOR RESIDUE GLN S 907
source : AC7

3) chain S
residue 123
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GLN S 907
source : AC7

4) chain S
residue 124
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GLN S 907
source : AC7

5) chain S
residue 147
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GLN S 907
source : AC7

6) chain S
residue 167
type
ligand
sequence D
description BINDING SITE FOR RESIDUE GLN S 907
source : AC7

7) chain S
residue 168
type
ligand
sequence T
description BINDING SITE FOR RESIDUE GLN S 907
source : AC7

8) chain S
residue 169
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GLN S 907
source : AC7

9) chain S
residue 171
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GLN S 907
source : AC7

10) chain S
residue 302
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE GLN S 907
source : AC7

11) chain S
residue 303
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE GLN S 907
source : AC7

12) chain S
residue 351
type
ligand
sequence R
description BINDING SITE FOR RESIDUE GLN S 907
source : AC7

13) chain S
residue 418
type
ligand
sequence D
description BINDING SITE FOR RESIDUE GLN S 907
source : AC7

14) chain S
residue 72
type ACT_SITE
ligand
sequence K
description Charge relay system (By similarity).
source Swiss-Prot : SWS_FT_FI13

15) chain S
residue 147
type ACT_SITE
ligand
sequence S
description Charge relay system (By similarity).
source Swiss-Prot : SWS_FT_FI13

16) chain S
residue 171
type ACT_SITE
ligand
sequence S
description Acyl-ester intermediate (By similarity).
source Swiss-Prot : SWS_FT_FI14

17) chain S
residue 72
type binding
ligand GLN: GLUTAMINE
sequence K
description GLUTAMINE binding site
source pdb_hetatom : GLN_3h0m_S_907

18) chain S
residue 121-124
type binding
ligand GLN: GLUTAMINE
sequence AMGS
description GLUTAMINE binding site
source pdb_hetatom : GLN_3h0m_S_907

19) chain S
residue 146-147
type binding
ligand GLN: GLUTAMINE
sequence GS
description GLUTAMINE binding site
source pdb_hetatom : GLN_3h0m_S_907

20) chain S
residue 166-171
type binding
ligand GLN: GLUTAMINE
sequence SDTGGS
description GLUTAMINE binding site
source pdb_hetatom : GLN_3h0m_S_907

21) chain S
residue 199
type binding
ligand GLN: GLUTAMINE
sequence F
description GLUTAMINE binding site
source pdb_hetatom : GLN_3h0m_S_907

22) chain S
residue 302-303
type binding
ligand GLN: GLUTAMINE
sequence YY
description GLUTAMINE binding site
source pdb_hetatom : GLN_3h0m_S_907

23) chain S
residue 351
type binding
ligand GLN: GLUTAMINE
sequence R
description GLUTAMINE binding site
source pdb_hetatom : GLN_3h0m_S_907

24) chain S
residue 418
type binding
ligand GLN: GLUTAMINE
sequence D
description GLUTAMINE binding site
source pdb_hetatom : GLN_3h0m_S_907

25) chain S
residue 422
type binding
ligand GLN: GLUTAMINE
sequence V
description GLUTAMINE binding site
source pdb_hetatom : GLN_3h0m_S_907


Display surface

Download
Links