eF-site ID 3h0m-P
PDB Code 3h0m
Chain P

click to enlarge
Title Structure of trna-dependent amidotransferase gatcab from aquifex aeolicus
Classification LIGASE
Compound Glutamyl-tRNA(Gln) amidotransferase subunit A
Source Aquifex aeolicus (GATC_AQUAE)
Sequence P:  MLWKKSLSELRELLKRGEVSPKEVVESFYDRYNQTEEKVK
AYITPLYGKALKQAESLKERELPLFGIPIAVKDNILVEGE
KTTCASKILENFVAPYDATVIERLKKAGALIVGKTNLDEF
AMGSSTEYSAFFPTKNPWDLERVPGGSSGGSAASVAVLSA
PVSLGSDTGGSIRQPASFCGVIGIKPTYGRVSRYGLVAFA
SSLDQIGVFGRRTEDVALVLEVISGWDEKDSTSAKVPVPE
WSEEVKKEVKGLKIGLPKEFFEYELQPQVKEAFENFIKEL
EKEGFEIKEVSLPHVKYSIPTYYIIAPSEASSNLARYDGV
RYGYRAKEYKDIFEMYARTRDEGFGPEVKRRIMLGTFALS
AGYYDAYYLKAQKVRRLITNDFLKAFEEVDVIASPTTPTL
PFKFGERLENPIEMYLSDILTVPANLAGLPAISIPIAWKD
GLPVGGQLIGKHWDETTLLQISYLWEQKFKHYEKIPLT
Description (1)  Glutamyl-tRNA(Gln) amidotransferase subunit A (E.C.6.3.5.-), Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B (E.C.6.3.5.-), Glutamyl-tRNA(Gln) amidotransferase subunit C (E.C.6.3.5.-)


Functional site

1) chain P
residue 122
type
ligand
sequence M
description BINDING SITE FOR RESIDUE GLN P 906
source : AC6

2) chain P
residue 123
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GLN P 906
source : AC6

3) chain P
residue 124
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GLN P 906
source : AC6

4) chain P
residue 167
type
ligand
sequence D
description BINDING SITE FOR RESIDUE GLN P 906
source : AC6

5) chain P
residue 168
type
ligand
sequence T
description BINDING SITE FOR RESIDUE GLN P 906
source : AC6

6) chain P
residue 169
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GLN P 906
source : AC6

7) chain P
residue 170
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GLN P 906
source : AC6

8) chain P
residue 171
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GLN P 906
source : AC6

9) chain P
residue 199
type
ligand
sequence F
description BINDING SITE FOR RESIDUE GLN P 906
source : AC6

10) chain P
residue 302
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE GLN P 906
source : AC6

11) chain P
residue 303
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE GLN P 906
source : AC6

12) chain P
residue 351
type
ligand
sequence R
description BINDING SITE FOR RESIDUE GLN P 906
source : AC6

13) chain P
residue 418
type
ligand
sequence D
description BINDING SITE FOR RESIDUE GLN P 906
source : AC6

14) chain P
residue 72
type ACT_SITE
ligand
sequence K
description Charge relay system (By similarity).
source Swiss-Prot : SWS_FT_FI11

15) chain P
residue 147
type ACT_SITE
ligand
sequence S
description Charge relay system (By similarity).
source Swiss-Prot : SWS_FT_FI11

16) chain P
residue 171
type ACT_SITE
ligand
sequence S
description Acyl-ester intermediate (By similarity).
source Swiss-Prot : SWS_FT_FI12

17) chain P
residue 121-124
type binding
ligand GLN: GLUTAMINE
sequence AMGS
description GLUTAMINE binding site
source pdb_hetatom : GLN_3h0m_P_906

18) chain P
residue 147
type binding
ligand GLN: GLUTAMINE
sequence S
description GLUTAMINE binding site
source pdb_hetatom : GLN_3h0m_P_906

19) chain P
residue 166-172
type binding
ligand GLN: GLUTAMINE
sequence SDTGGSI
description GLUTAMINE binding site
source pdb_hetatom : GLN_3h0m_P_906

20) chain P
residue 199
type binding
ligand GLN: GLUTAMINE
sequence F
description GLUTAMINE binding site
source pdb_hetatom : GLN_3h0m_P_906

21) chain P
residue 302-303
type binding
ligand GLN: GLUTAMINE
sequence YY
description GLUTAMINE binding site
source pdb_hetatom : GLN_3h0m_P_906

22) chain P
residue 351
type binding
ligand GLN: GLUTAMINE
sequence R
description GLUTAMINE binding site
source pdb_hetatom : GLN_3h0m_P_906

23) chain P
residue 418
type binding
ligand GLN: GLUTAMINE
sequence D
description GLUTAMINE binding site
source pdb_hetatom : GLN_3h0m_P_906

24) chain P
residue 425
type binding
ligand GLN: GLUTAMINE
sequence N
description GLUTAMINE binding site
source pdb_hetatom : GLN_3h0m_P_906


Display surface

Download
Links