eF-site ID 3h0m-M
PDB Code 3h0m
Chain M

click to enlarge
Title Structure of trna-dependent amidotransferase gatcab from aquifex aeolicus
Classification LIGASE
Compound Glutamyl-tRNA(Gln) amidotransferase subunit A
Source Aquifex aeolicus (GATC_AQUAE)
Sequence M:  MLWKKSLSELRELLKRGEVSPKEVVESFYDRYNQTEEKVK
AYITPLYGKALKQAESLKERELPLFGIPIAVKDNILVEGE
KTTCASKILENFVAPYDATVIERLKKAGALIVGKTNLDEF
AMGSSTEYSAFFPTKNPWDLERVPGGSSGGSAASVAVLSA
PVSLGSDTGGSIRQPASFCGVIGIKPTYGRVSRYGLVAFA
SSLDQIGVFGRRTEDVALVLEVISGWDEKDSTSAKVPVPE
WSEEVKKEVKGLKIGLPKEFFEYELQPQVKEAFENFIKEL
EKEGFEIKEVSLPHVKYSIPTYYIIAPSEASSNLARYDGV
RYGYRAKEYKDIFEMYARTRDEGFGPEVKRRIMLGTFALS
AGYYDAYYLKAQKVRRLITNDFLKAFEEVDVIASPTTPTL
PFKFGERLENPIEMYLSDILTVPANLAGLPAISIPIAWKD
GLPVGGQLIGKHWDETTLLQISYLWEQKFKHYEKIPLT
Description (1)  Glutamyl-tRNA(Gln) amidotransferase subunit A (E.C.6.3.5.-), Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B (E.C.6.3.5.-), Glutamyl-tRNA(Gln) amidotransferase subunit C (E.C.6.3.5.-)


Functional site

1) chain M
residue 122
type
ligand
sequence M
description BINDING SITE FOR RESIDUE GLN M 905
source : AC5

2) chain M
residue 123
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GLN M 905
source : AC5

3) chain M
residue 124
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GLN M 905
source : AC5

4) chain M
residue 167
type
ligand
sequence D
description BINDING SITE FOR RESIDUE GLN M 905
source : AC5

5) chain M
residue 168
type
ligand
sequence T
description BINDING SITE FOR RESIDUE GLN M 905
source : AC5

6) chain M
residue 169
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GLN M 905
source : AC5

7) chain M
residue 170
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GLN M 905
source : AC5

8) chain M
residue 171
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GLN M 905
source : AC5

9) chain M
residue 199
type
ligand
sequence F
description BINDING SITE FOR RESIDUE GLN M 905
source : AC5

10) chain M
residue 302
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE GLN M 905
source : AC5

11) chain M
residue 351
type
ligand
sequence R
description BINDING SITE FOR RESIDUE GLN M 905
source : AC5

12) chain M
residue 418
type
ligand
sequence D
description BINDING SITE FOR RESIDUE GLN M 905
source : AC5

13) chain M
residue 72
type ACT_SITE
ligand
sequence K
description Charge relay system (By similarity).
source Swiss-Prot : SWS_FT_FI9

14) chain M
residue 147
type ACT_SITE
ligand
sequence S
description Charge relay system (By similarity).
source Swiss-Prot : SWS_FT_FI9

15) chain M
residue 171
type ACT_SITE
ligand
sequence S
description Acyl-ester intermediate (By similarity).
source Swiss-Prot : SWS_FT_FI10

16) chain M
residue 121-124
type binding
ligand GLN: GLUTAMINE
sequence AMGS
description GLUTAMINE binding site
source pdb_hetatom : GLN_3h0m_M_905

17) chain M
residue 146-147
type binding
ligand GLN: GLUTAMINE
sequence GS
description GLUTAMINE binding site
source pdb_hetatom : GLN_3h0m_M_905

18) chain M
residue 166-172
type binding
ligand GLN: GLUTAMINE
sequence SDTGGSI
description GLUTAMINE binding site
source pdb_hetatom : GLN_3h0m_M_905

19) chain M
residue 199
type binding
ligand GLN: GLUTAMINE
sequence F
description GLUTAMINE binding site
source pdb_hetatom : GLN_3h0m_M_905

20) chain M
residue 302-303
type binding
ligand GLN: GLUTAMINE
sequence YY
description GLUTAMINE binding site
source pdb_hetatom : GLN_3h0m_M_905

21) chain M
residue 351
type binding
ligand GLN: GLUTAMINE
sequence R
description GLUTAMINE binding site
source pdb_hetatom : GLN_3h0m_M_905

22) chain M
residue 418
type binding
ligand GLN: GLUTAMINE
sequence D
description GLUTAMINE binding site
source pdb_hetatom : GLN_3h0m_M_905


Display surface

Download
Links