eF-site ID 3h0m-J
PDB Code 3h0m
Chain J

click to enlarge
Title Structure of trna-dependent amidotransferase gatcab from aquifex aeolicus
Classification LIGASE
Compound Glutamyl-tRNA(Gln) amidotransferase subunit A
Source Aquifex aeolicus (GATC_AQUAE)
Sequence J:  MLWKKSLSELRELLKRGEVSPKEVVESFYDRYNQTEEKVK
AYITPLYGKALKQAESLKERELPLFGIPIAVKDNILVEGE
KTTCASKILENFVAPYDATVIERLKKAGALIVGKTNLDEF
AMGSSTEYSAFFPTKNPWDLERVPGGSSGGSAASVAVLSA
PVSLGSDTGGSIRQPASFCGVIGIKPTYGRVSRYGLVAFA
SSLDQIGVFGRRTEDVALVLEVISGWDEKDSTSAKVPVPE
WSEEVKKEVKGLKIGLPKEFFEYELQPQVKEAFENFIKEL
EKEGFEIKEVSLPHVKYSIPTYYIIAPSEASSNLARYDGV
RYGYRAKEYKDIFEMYARTRDEGFGPEVKRRIMLGTFALS
AGYYDAYYLKAQKVRRLITNDFLKAFEEVDVIASPTTPTL
PFKFGERLENPIEMYLSDILTVPANLAGLPAISIPIAWKD
GLPVGGQLIGKHWDETTLLQISYLWEQKFKHYEKIPLT
Description (1)  Glutamyl-tRNA(Gln) amidotransferase subunit A (E.C.6.3.5.-), Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B (E.C.6.3.5.-), Glutamyl-tRNA(Gln) amidotransferase subunit C (E.C.6.3.5.-)


Functional site

1) chain J
residue 121
type
ligand
sequence A
description BINDING SITE FOR RESIDUE GLN J 904
source : AC4

2) chain J
residue 122
type
ligand
sequence M
description BINDING SITE FOR RESIDUE GLN J 904
source : AC4

3) chain J
residue 123
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GLN J 904
source : AC4

4) chain J
residue 167
type
ligand
sequence D
description BINDING SITE FOR RESIDUE GLN J 904
source : AC4

5) chain J
residue 168
type
ligand
sequence T
description BINDING SITE FOR RESIDUE GLN J 904
source : AC4

6) chain J
residue 169
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GLN J 904
source : AC4

7) chain J
residue 170
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GLN J 904
source : AC4

8) chain J
residue 171
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GLN J 904
source : AC4

9) chain J
residue 199
type
ligand
sequence F
description BINDING SITE FOR RESIDUE GLN J 904
source : AC4

10) chain J
residue 302
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE GLN J 904
source : AC4

11) chain J
residue 303
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE GLN J 904
source : AC4

12) chain J
residue 351
type
ligand
sequence R
description BINDING SITE FOR RESIDUE GLN J 904
source : AC4

13) chain J
residue 418
type
ligand
sequence D
description BINDING SITE FOR RESIDUE GLN J 904
source : AC4

14) chain J
residue 72
type ACT_SITE
ligand
sequence K
description Charge relay system (By similarity).
source Swiss-Prot : SWS_FT_FI7

15) chain J
residue 147
type ACT_SITE
ligand
sequence S
description Charge relay system (By similarity).
source Swiss-Prot : SWS_FT_FI7

16) chain J
residue 171
type ACT_SITE
ligand
sequence S
description Acyl-ester intermediate (By similarity).
source Swiss-Prot : SWS_FT_FI8

17) chain J
residue 121-124
type binding
ligand GLN: GLUTAMINE
sequence AMGS
description GLUTAMINE binding site
source pdb_hetatom : GLN_3h0m_J_904

18) chain J
residue 147
type binding
ligand GLN: GLUTAMINE
sequence S
description GLUTAMINE binding site
source pdb_hetatom : GLN_3h0m_J_904

19) chain J
residue 166-171
type binding
ligand GLN: GLUTAMINE
sequence SDTGGS
description GLUTAMINE binding site
source pdb_hetatom : GLN_3h0m_J_904

20) chain J
residue 199
type binding
ligand GLN: GLUTAMINE
sequence F
description GLUTAMINE binding site
source pdb_hetatom : GLN_3h0m_J_904

21) chain J
residue 302-303
type binding
ligand GLN: GLUTAMINE
sequence YY
description GLUTAMINE binding site
source pdb_hetatom : GLN_3h0m_J_904

22) chain J
residue 351
type binding
ligand GLN: GLUTAMINE
sequence R
description GLUTAMINE binding site
source pdb_hetatom : GLN_3h0m_J_904

23) chain J
residue 418
type binding
ligand GLN: GLUTAMINE
sequence D
description GLUTAMINE binding site
source pdb_hetatom : GLN_3h0m_J_904


Display surface

Download
Links