eF-site ID 3h0m-G
PDB Code 3h0m
Chain G

click to enlarge
Title Structure of trna-dependent amidotransferase gatcab from aquifex aeolicus
Classification LIGASE
Compound Glutamyl-tRNA(Gln) amidotransferase subunit A
Source Aquifex aeolicus (GATC_AQUAE)
Sequence G:  MLWKKSLSELRELLKRGEVSPKEVVESFYDRYNQTEEKVK
AYITPLYGKALKQAESLKERELPLFGIPIAVKDNILVEGE
KTTCASKILENFVAPYDATVIERLKKAGALIVGKTNLDEF
AMGSSTEYSAFFPTKNPWDLERVPGGSSGGSAASVAVLSA
PVSLGSDTGGSIRQPASFCGVIGIKPTYGRVSRYGLVAFA
SSLDQIGVFGRRTEDVALVLEVISGWDEKDSTSAKVPVPE
WSEEVKKEVKGLKIGLPKEFFEYELQPQVKEAFENFIKEL
EKEGFEIKEVSLPHVKYSIPTYYIIAPSEASSNLARYDGV
RYGYRAKEYKDIFEMYARTRDEGFGPEVKRRIMLGTFALS
AGYYDAYYLKAQKVRRLITNDFLKAFEEVDVIASPTTPTL
PFKFGERLENPIEMYLSDILTVPANLAGLPAISIPIAWKD
GLPVGGQLIGKHWDETTLLQISYLWEQKFKHYEKIPLT
Description (1)  Glutamyl-tRNA(Gln) amidotransferase subunit A (E.C.6.3.5.-), Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B (E.C.6.3.5.-), Glutamyl-tRNA(Gln) amidotransferase subunit C (E.C.6.3.5.-)


Functional site

1) chain G
residue 121
type
ligand
sequence A
description BINDING SITE FOR RESIDUE GLN G 903
source : AC3

2) chain G
residue 122
type
ligand
sequence M
description BINDING SITE FOR RESIDUE GLN G 903
source : AC3

3) chain G
residue 123
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GLN G 903
source : AC3

4) chain G
residue 124
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GLN G 903
source : AC3

5) chain G
residue 147
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GLN G 903
source : AC3

6) chain G
residue 166
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GLN G 903
source : AC3

7) chain G
residue 167
type
ligand
sequence D
description BINDING SITE FOR RESIDUE GLN G 903
source : AC3

8) chain G
residue 168
type
ligand
sequence T
description BINDING SITE FOR RESIDUE GLN G 903
source : AC3

9) chain G
residue 169
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GLN G 903
source : AC3

10) chain G
residue 171
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GLN G 903
source : AC3

11) chain G
residue 199
type
ligand
sequence F
description BINDING SITE FOR RESIDUE GLN G 903
source : AC3

12) chain G
residue 302
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE GLN G 903
source : AC3

13) chain G
residue 351
type
ligand
sequence R
description BINDING SITE FOR RESIDUE GLN G 903
source : AC3

14) chain G
residue 418
type
ligand
sequence D
description BINDING SITE FOR RESIDUE GLN G 903
source : AC3

15) chain G
residue 72
type ACT_SITE
ligand
sequence K
description Charge relay system (By similarity).
source Swiss-Prot : SWS_FT_FI5

16) chain G
residue 147
type ACT_SITE
ligand
sequence S
description Charge relay system (By similarity).
source Swiss-Prot : SWS_FT_FI5

17) chain G
residue 171
type ACT_SITE
ligand
sequence S
description Acyl-ester intermediate (By similarity).
source Swiss-Prot : SWS_FT_FI6

18) chain G
residue 72
type binding
ligand GLN: GLUTAMINE
sequence K
description GLUTAMINE binding site
source pdb_hetatom : GLN_3h0m_G_903

19) chain G
residue 121-124
type binding
ligand GLN: GLUTAMINE
sequence AMGS
description GLUTAMINE binding site
source pdb_hetatom : GLN_3h0m_G_903

20) chain G
residue 146-147
type binding
ligand GLN: GLUTAMINE
sequence GS
description GLUTAMINE binding site
source pdb_hetatom : GLN_3h0m_G_903

21) chain G
residue 166-172
type binding
ligand GLN: GLUTAMINE
sequence SDTGGSI
description GLUTAMINE binding site
source pdb_hetatom : GLN_3h0m_G_903

22) chain G
residue 199
type binding
ligand GLN: GLUTAMINE
sequence F
description GLUTAMINE binding site
source pdb_hetatom : GLN_3h0m_G_903

23) chain G
residue 302-303
type binding
ligand GLN: GLUTAMINE
sequence YY
description GLUTAMINE binding site
source pdb_hetatom : GLN_3h0m_G_903

24) chain G
residue 351
type binding
ligand GLN: GLUTAMINE
sequence R
description GLUTAMINE binding site
source pdb_hetatom : GLN_3h0m_G_903

25) chain G
residue 418
type binding
ligand GLN: GLUTAMINE
sequence D
description GLUTAMINE binding site
source pdb_hetatom : GLN_3h0m_G_903


Display surface

Download
Links