eF-site ID 3h0m-D
PDB Code 3h0m
Chain D

click to enlarge
Title Structure of trna-dependent amidotransferase gatcab from aquifex aeolicus
Classification LIGASE
Compound Glutamyl-tRNA(Gln) amidotransferase subunit A
Source Aquifex aeolicus (GATC_AQUAE)
Sequence D:  MLWKKSLSELRELLKRGEVSPKEVVESFYDRYNQTEEKVK
AYITPLYGKALKQAESLKERELPLFGIPIAVKDNILVEGE
KTTCASKILENFVAPYDATVIERLKKAGALIVGKTNLDEF
AMGSSTEYSAFFPTKNPWDLERVPGGSSGGSAASVAVLSA
PVSLGSDTGGSIRQPASFCGVIGIKPTYGRVSRYGLVAFA
SSLDQIGVFGRRTEDVALVLEVISGWDEKDSTSAKVPVPE
WSEEVKKEVKGLKIGLPKEFFEYELQPQVKEAFENFIKEL
EKEGFEIKEVSLPHVKYSIPTYYIIAPSEASSNLARYDGV
RYGYRAKEYKDIFEMYARTRDEGFGPEVKRRIMLGTFALS
AGYYDAYYLKAQKVRRLITNDFLKAFEEVDVIASPTTPTL
PFKFGERLENPIEMYLSDILTVPANLAGLPAISIPIAWKD
GLPVGGQLIGKHWDETTLLQISYLWEQKFKHYEKIPLT
Description (1)  Glutamyl-tRNA(Gln) amidotransferase subunit A (E.C.6.3.5.-), Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B (E.C.6.3.5.-), Glutamyl-tRNA(Gln) amidotransferase subunit C (E.C.6.3.5.-)


Functional site

1) chain D
residue 121
type
ligand
sequence A
description BINDING SITE FOR RESIDUE GLN D 902
source : AC2

2) chain D
residue 122
type
ligand
sequence M
description BINDING SITE FOR RESIDUE GLN D 902
source : AC2

3) chain D
residue 123
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GLN D 902
source : AC2

4) chain D
residue 124
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GLN D 902
source : AC2

5) chain D
residue 167
type
ligand
sequence D
description BINDING SITE FOR RESIDUE GLN D 902
source : AC2

6) chain D
residue 168
type
ligand
sequence T
description BINDING SITE FOR RESIDUE GLN D 902
source : AC2

7) chain D
residue 169
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GLN D 902
source : AC2

8) chain D
residue 170
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GLN D 902
source : AC2

9) chain D
residue 171
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GLN D 902
source : AC2

10) chain D
residue 199
type
ligand
sequence F
description BINDING SITE FOR RESIDUE GLN D 902
source : AC2

11) chain D
residue 302
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE GLN D 902
source : AC2

12) chain D
residue 303
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE GLN D 902
source : AC2

13) chain D
residue 351
type
ligand
sequence R
description BINDING SITE FOR RESIDUE GLN D 902
source : AC2

14) chain D
residue 418
type
ligand
sequence D
description BINDING SITE FOR RESIDUE GLN D 902
source : AC2

15) chain D
residue 72
type ACT_SITE
ligand
sequence K
description Charge relay system (By similarity).
source Swiss-Prot : SWS_FT_FI3

16) chain D
residue 147
type ACT_SITE
ligand
sequence S
description Charge relay system (By similarity).
source Swiss-Prot : SWS_FT_FI3

17) chain D
residue 171
type ACT_SITE
ligand
sequence S
description Acyl-ester intermediate (By similarity).
source Swiss-Prot : SWS_FT_FI4

18) chain D
residue 121-124
type binding
ligand GLN: GLUTAMINE
sequence AMGS
description GLUTAMINE binding site
source pdb_hetatom : GLN_3h0m_D_902

19) chain D
residue 146-147
type binding
ligand GLN: GLUTAMINE
sequence GS
description GLUTAMINE binding site
source pdb_hetatom : GLN_3h0m_D_902

20) chain D
residue 166-172
type binding
ligand GLN: GLUTAMINE
sequence SDTGGSI
description GLUTAMINE binding site
source pdb_hetatom : GLN_3h0m_D_902

21) chain D
residue 199
type binding
ligand GLN: GLUTAMINE
sequence F
description GLUTAMINE binding site
source pdb_hetatom : GLN_3h0m_D_902

22) chain D
residue 302-303
type binding
ligand GLN: GLUTAMINE
sequence YY
description GLUTAMINE binding site
source pdb_hetatom : GLN_3h0m_D_902

23) chain D
residue 351
type binding
ligand GLN: GLUTAMINE
sequence R
description GLUTAMINE binding site
source pdb_hetatom : GLN_3h0m_D_902

24) chain D
residue 418
type binding
ligand GLN: GLUTAMINE
sequence D
description GLUTAMINE binding site
source pdb_hetatom : GLN_3h0m_D_902


Display surface

Download
Links