eF-site ID 3h0l-W
PDB Code 3h0l
Chain W

click to enlarge
Title Structure of trna-dependent amidotransferase gatcab from aquifex aeolicus
Classification LIGASE
Compound Glutamyl-tRNA(Gln) amidotransferase subunit A
Source Aquifex aeolicus (GATC_AQUAE)
Sequence W:  EKYEAVIGLEIHVQMDTKTKMFCGCKVEFGAEPNTNVCPV
CLGMPGALPIVNKRAVEYAIRASLALNCEVHEESVFARKH
YFYPDLPKGYQISQYEKPLATNGWVELNLPNGEKKKVRIR
RLHIEEDAGKNIHEGDKTLVDLNRAGTPLMEIVTEPDIRT
PEEARLFLEKLRNIMRYAGVSKADMEKGQLRCDINVSIRP
KGSKEFGTRVEIKNVNSFRFVQKALEYEIERQINVVEEGG
EVVQETRTFDPQTGKTYPMRTKEEAEDYRYFPDPDLVPLK
VKKEWIEEIKKNMPELPDQRFERLIKEYGLSEYEAGILVN
HKEVGDFFEEAVRHFKEPKGIVNWLINDLLGLLRDKGISI
EESPVKPEHLAELVKLIKEKVISTKIGKEVIKEMVETGKT
PSQIVEEKGL
Description (1)  Glutamyl-tRNA(Gln) amidotransferase subunit A (E.C.6.3.5.-), Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B (E.C.6.3.5.-), Glutamyl-tRNA(Gln) amidotransferase subunit C (E.C.6.3.5.-)


Functional site

1) chain W
residue 8
type
ligand
sequence V
description BINDING SITE FOR RESIDUE ADP W 708
source : CC4

2) chain W
residue 10
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ADP W 708
source : CC4

3) chain W
residue 11
type
ligand
sequence L
description BINDING SITE FOR RESIDUE ADP W 708
source : CC4

4) chain W
residue 12
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP W 708
source : CC4

5) chain W
residue 155
type
ligand
sequence V
description BINDING SITE FOR RESIDUE ADP W 708
source : CC4

6) chain W
residue 156
type
ligand
sequence T
description BINDING SITE FOR RESIDUE ADP W 708
source : CC4

7) chain W
residue 157
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP W 708
source : CC4

8) chain W
residue 158
type
ligand
sequence P
description BINDING SITE FOR RESIDUE ADP W 708
source : CC4

9) chain W
residue 197
type
ligand
sequence N
description BINDING SITE FOR RESIDUE ADP W 708
source : CC4

10) chain W
residue 199
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ADP W 708
source : CC4

11) chain W
residue 209
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ADP W 708
source : CC4

12) chain W
residue 211
type
ligand
sequence R
description BINDING SITE FOR RESIDUE ADP W 708
source : CC4

13) chain W
residue 14
type
ligand
sequence H
description BINDING SITE FOR RESIDUE MG W 808
source : CC5

14) chain W
residue 127
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MG W 808
source : CC5

15) chain W
residue 153
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MG W 808
source : CC5

16) chain W
residue 25
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN W 908
source : CC6

17) chain W
residue 27
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN W 908
source : CC6

18) chain W
residue 40
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN W 908
source : CC6

19) chain W
residue 43
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN W 908
source : CC6

20) chain W
residue 8-12
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence VIGLE
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_W_708

21) chain W
residue 122
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_W_708

22) chain W
residue 155-158
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence VTEP
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_W_708

23) chain W
residue 197-199
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence NVS
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_W_708

24) chain W
residue 208-211
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence FGTR
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_W_708


Display surface

Download
Links