eF-site ID 3h0l-V PDB Code 3h0l Chain V click to enlarge Title Structure of trna-dependent amidotransferase gatcab from aquifex aeolicus Classification LIGASE Compound Glutamyl-tRNA(Gln) amidotransferase subunit A Source Aquifex aeolicus (GATC_AQUAE) Sequence V:  MLWKKSLSELRELLKRGEVSPKEVVESFYDRYNQTEEKVK AYITPLYGKALKQAESLKERELPLFGIPIAVKDNILVEGE KTTCASKILENFVAPYDATVIERLKKAGALIVGKTNLDEF AMGSSTEYSAFFPTKNPWDLERVPGGSSGGSAASVAVLSA PVSLGSDTGGSIRQPASFCGVIGIKPTYGRVSRYGLVAFA SSLDQIGVFGRRTEDVALVLEVISGWDEKDSTSAKVPVPE WSEEVKKEVKGLKIGLPKEFFEYELQPQVKEAFENFIKEL EKEGFEIKEVSLPHVKYSIPTYYIIAPSEASSNLARYDGV RYGYRAKEYKDIFEMYARTRDEGFGPEVKRRIMLGTFALS AGYYDAYYLKAQKVRRLITNDFLKAFEEVDVIASPTTPTL PFKFGERLENPIEMYLSDILTVPANLAGLPAISIPIAWKD GLPVGGQLIGKHWDETTLLQISYLWEQKFKHYEKIPLT Description (1)  Glutamyl-tRNA(Gln) amidotransferase subunit A (E.C.6.3.5.-), Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B (E.C.6.3.5.-), Glutamyl-tRNA(Gln) amidotransferase subunit C (E.C.6.3.5.-) Functional site 1) chain V residue 121 type ligand sequence A description BINDING SITE FOR RESIDUE ASN V 908 source : DC5 2) chain V residue 123 type ligand sequence G description BINDING SITE FOR RESIDUE ASN V 908 source : DC5 3) chain V residue 169 type ligand sequence G description BINDING SITE FOR RESIDUE ASN V 908 source : DC5 4) chain V residue 170 type ligand sequence G description BINDING SITE FOR RESIDUE ASN V 908 source : DC5 5) chain V residue 171 type ligand sequence S description BINDING SITE FOR RESIDUE ASN V 908 source : DC5 6) chain V residue 199 type ligand sequence F description BINDING SITE FOR RESIDUE ASN V 908 source : DC5 7) chain V residue 302 type ligand sequence Y description BINDING SITE FOR RESIDUE ASN V 908 source : DC5 8) chain V residue 351 type ligand sequence R description BINDING SITE FOR RESIDUE ASN V 908 source : DC5 9) chain V residue 418 type ligand sequence D description BINDING SITE FOR RESIDUE ASN V 908 source : DC5 10) chain V residue 72 type ACT_SITE ligand sequence K description Charge relay system (By similarity). source Swiss-Prot : SWS_FT_FI15 11) chain V residue 147 type ACT_SITE ligand sequence S description Charge relay system (By similarity). source Swiss-Prot : SWS_FT_FI15 12) chain V residue 171 type ACT_SITE ligand sequence S description Acyl-ester intermediate (By similarity). source Swiss-Prot : SWS_FT_FI16 13) chain V residue 145-176 type prosite ligand sequence GGSSGGSAASVAVLSAPVSLGSDTGGSIRQPA description Amidases signature.G-[GAV]-S-[GS](2)-G-x-[GSAE]-[GSAVYCT]-x-[LIVMT]-[GSA]-x(6)-[GSAT]-x-[GA]-x-[DE]-x-[GA]-x-S-[LIVM]-R-x-P-[GSACTL]. source prosite : PS00571 14) chain V residue 121-124 type binding ligand ASN: ASPARAGINE sequence AMGS description ASPARAGINE binding site source pdb_hetatom : ASN_3h0l_V_908 15) chain V residue 146-147 type binding ligand ASN: ASPARAGINE sequence GS description ASPARAGINE binding site source pdb_hetatom : ASN_3h0l_V_908 16) chain V residue 167-171 type binding ligand ASN: ASPARAGINE sequence DTGGS description ASPARAGINE binding site source pdb_hetatom : ASN_3h0l_V_908 17) chain V residue 199 type binding ligand ASN: ASPARAGINE sequence F description ASPARAGINE binding site source pdb_hetatom : ASN_3h0l_V_908 18) chain V residue 302-303 type binding ligand ASN: ASPARAGINE sequence YY description ASPARAGINE binding site source pdb_hetatom : ASN_3h0l_V_908 19) chain V residue 351 type binding ligand ASN: ASPARAGINE sequence R description ASPARAGINE binding site source pdb_hetatom : ASN_3h0l_V_908 20) chain V residue 418 type binding ligand ASN: ASPARAGINE sequence D description ASPARAGINE binding site source pdb_hetatom : ASN_3h0l_V_908

Display surface Download Links