eF-site ID 3h0l-T
PDB Code 3h0l
Chain T

click to enlarge
Title Structure of trna-dependent amidotransferase gatcab from aquifex aeolicus
Classification LIGASE
Compound Glutamyl-tRNA(Gln) amidotransferase subunit A
Source Aquifex aeolicus (GATC_AQUAE)
Sequence T:  EKYEAVIGLEIHVQMDTKTKMFCGCKVEFGAEPNTNVCPV
CLGMPGALPIVNKRAVEYAIRASLALNCEVHEESVFARKH
YFYPDLPKGYQISQYEKPLATNGWVELNLPNGEKKKVRIR
RLHIEEDAGKNIHEGDKTLVDLNRAGTPLMEIVTEPDIRT
PEEARLFLEKLRNIMRYAGVSKADMEKGQLRCDINVSIRP
KGSKEFGTRVEIKNVNSFRFVQKALEYEIERQINVVEEGG
EVVQETRTFDPQTGKTYPMRTKEEAEDYRYFPDPDLVPLK
VKKEWIEEIKKNMPELPDQRFERLIKEYGLSEYEAGILVN
HKEVGDFFEEAVRHFKEPKGIVNWLINDLLGLLRDKGISI
EESPVKPEHLAELVKLIKEKVISTKIGKEVIKEMVETGKT
PSQIVEEKGL
Description (1)  Glutamyl-tRNA(Gln) amidotransferase subunit A (E.C.6.3.5.-), Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B (E.C.6.3.5.-), Glutamyl-tRNA(Gln) amidotransferase subunit C (E.C.6.3.5.-)


Functional site

1) chain T
residue 8
type
ligand
sequence V
description BINDING SITE FOR RESIDUE ADP T 707
source : CC1

2) chain T
residue 10
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ADP T 707
source : CC1

3) chain T
residue 11
type
ligand
sequence L
description BINDING SITE FOR RESIDUE ADP T 707
source : CC1

4) chain T
residue 12
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP T 707
source : CC1

5) chain T
residue 155
type
ligand
sequence V
description BINDING SITE FOR RESIDUE ADP T 707
source : CC1

6) chain T
residue 156
type
ligand
sequence T
description BINDING SITE FOR RESIDUE ADP T 707
source : CC1

7) chain T
residue 157
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP T 707
source : CC1

8) chain T
residue 158
type
ligand
sequence P
description BINDING SITE FOR RESIDUE ADP T 707
source : CC1

9) chain T
residue 197
type
ligand
sequence N
description BINDING SITE FOR RESIDUE ADP T 707
source : CC1

10) chain T
residue 199
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ADP T 707
source : CC1

11) chain T
residue 209
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ADP T 707
source : CC1

12) chain T
residue 211
type
ligand
sequence R
description BINDING SITE FOR RESIDUE ADP T 707
source : CC1

13) chain T
residue 14
type
ligand
sequence H
description BINDING SITE FOR RESIDUE MG T 807
source : CC2

14) chain T
residue 127
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MG T 807
source : CC2

15) chain T
residue 153
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MG T 807
source : CC2

16) chain T
residue 25
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN T 907
source : CC3

17) chain T
residue 27
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN T 907
source : CC3

18) chain T
residue 40
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN T 907
source : CC3

19) chain T
residue 43
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN T 907
source : CC3

20) chain T
residue 8-12
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence VIGLE
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_T_707

21) chain T
residue 155-158
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence VTEP
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_T_707

22) chain T
residue 197-199
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence NVS
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_T_707

23) chain T
residue 208-209
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence FG
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_T_707

24) chain T
residue 211
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_T_707


Display surface

Download
Links