eF-site ID 3h0l-Q
PDB Code 3h0l
Chain Q

click to enlarge
Title Structure of trna-dependent amidotransferase gatcab from aquifex aeolicus
Classification LIGASE
Compound Glutamyl-tRNA(Gln) amidotransferase subunit A
Source Aquifex aeolicus (GATC_AQUAE)
Sequence Q:  EKYEAVIGLEIHVQMDTKTKMFCGCKVEFGAEPNTNVCPV
CLGMPGALPIVNKRAVEYAIRASLALNCEVHEESVFARKH
YFYPDLPKGYQISQYEKPLATNGWVELNLPNGEKKKVRIR
RLHIEEDAGKNIHEGDKTLVDLNRAGTPLMEIVTEPDIRT
PEEARLFLEKLRNIMRYAGVSKADMEKGQLRCDINVSIRP
KGSKEFGTRVEIKNVNSFRFVQKALEYEIERQINVVEEGG
EVVQETRTFDPQTGKTYPMRTKEEAEDYRYFPDPDLVPLK
VKKEWIEEIKKNMPELPDQRFERLIKEYGLSEYEAGILVN
HKEVGDFFEEAVRHFKEPKGIVNWLINDLLGLLRDKGISI
EESPVKPEHLAELVKLIKEKVISTKIGKEVIKEMVETGKT
PSQIVEEKGL
Description (1)  Glutamyl-tRNA(Gln) amidotransferase subunit A (E.C.6.3.5.-), Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B (E.C.6.3.5.-), Glutamyl-tRNA(Gln) amidotransferase subunit C (E.C.6.3.5.-)


Functional site

1) chain Q
residue 8
type
ligand
sequence V
description BINDING SITE FOR RESIDUE ADP Q 706
source : BC7

2) chain Q
residue 10
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ADP Q 706
source : BC7

3) chain Q
residue 11
type
ligand
sequence L
description BINDING SITE FOR RESIDUE ADP Q 706
source : BC7

4) chain Q
residue 12
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP Q 706
source : BC7

5) chain Q
residue 155
type
ligand
sequence V
description BINDING SITE FOR RESIDUE ADP Q 706
source : BC7

6) chain Q
residue 156
type
ligand
sequence T
description BINDING SITE FOR RESIDUE ADP Q 706
source : BC7

7) chain Q
residue 157
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP Q 706
source : BC7

8) chain Q
residue 158
type
ligand
sequence P
description BINDING SITE FOR RESIDUE ADP Q 706
source : BC7

9) chain Q
residue 197
type
ligand
sequence N
description BINDING SITE FOR RESIDUE ADP Q 706
source : BC7

10) chain Q
residue 198
type
ligand
sequence V
description BINDING SITE FOR RESIDUE ADP Q 706
source : BC7

11) chain Q
residue 199
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ADP Q 706
source : BC7

12) chain Q
residue 209
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ADP Q 706
source : BC7

13) chain Q
residue 211
type
ligand
sequence R
description BINDING SITE FOR RESIDUE ADP Q 706
source : BC7

14) chain Q
residue 14
type
ligand
sequence H
description BINDING SITE FOR RESIDUE MG Q 806
source : BC8

15) chain Q
residue 127
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MG Q 806
source : BC8

16) chain Q
residue 153
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MG Q 806
source : BC8

17) chain Q
residue 25
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN Q 906
source : BC9

18) chain Q
residue 27
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN Q 906
source : BC9

19) chain Q
residue 40
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN Q 906
source : BC9

20) chain Q
residue 43
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN Q 906
source : BC9

21) chain Q
residue 8-12
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence VIGLE
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_Q_706

22) chain Q
residue 122
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_Q_706

23) chain Q
residue 155-158
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence VTEP
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_Q_706

24) chain Q
residue 197-199
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence NVS
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_Q_706

25) chain Q
residue 208-209
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence FG
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_Q_706

26) chain Q
residue 211
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_Q_706


Display surface

Download
Links