eF-site ID 3h0l-P
PDB Code 3h0l
Chain P

click to enlarge
Title Structure of trna-dependent amidotransferase gatcab from aquifex aeolicus
Classification LIGASE
Compound Glutamyl-tRNA(Gln) amidotransferase subunit A
Source Aquifex aeolicus (GATC_AQUAE)
Sequence P:  MLWKKSLSELRELLKRGEVSPKEVVESFYDRYNQTEEKVK
AYITPLYGKALKQAESLKERELPLFGIPIAVKDNILVEGE
KTTCASKILENFVAPYDATVIERLKKAGALIVGKTNLDEF
AMGSSTEYSAFFPTKNPWDLERVPGGSSGGSAASVAVLSA
PVSLGSDTGGSIRQPASFCGVIGIKPTYGRVSRYGLVAFA
SSLDQIGVFGRRTEDVALVLEVISGWDEKDSTSAKVPVPE
WSEEVKKEVKGLKIGLPKEFFEYELQPQVKEAFENFIKEL
EKEGFEIKEVSLPHVKYSIPTYYIIAPSEASSNLARYDGV
RYGYRAKEYKDIFEMYARTRDEGFGPEVKRRIMLGTFALS
AGYYDAYYLKAQKVRRLITNDFLKAFEEVDVIASPTTPTL
PFKFGERLENPIEMYLSDILTVPANLAGLPAISIPIAWKD
GLPVGGQLIGKHWDETTLLQISYLWEQKFKHYEKIPLT
Description (1)  Glutamyl-tRNA(Gln) amidotransferase subunit A (E.C.6.3.5.-), Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B (E.C.6.3.5.-), Glutamyl-tRNA(Gln) amidotransferase subunit C (E.C.6.3.5.-)


Functional site

1) chain P
residue 121
type
ligand
sequence A
description BINDING SITE FOR RESIDUE ASN P 906
source : DC3

2) chain P
residue 122
type
ligand
sequence M
description BINDING SITE FOR RESIDUE ASN P 906
source : DC3

3) chain P
residue 123
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ASN P 906
source : DC3

4) chain P
residue 124
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ASN P 906
source : DC3

5) chain P
residue 147
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ASN P 906
source : DC3

6) chain P
residue 168
type
ligand
sequence T
description BINDING SITE FOR RESIDUE ASN P 906
source : DC3

7) chain P
residue 169
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ASN P 906
source : DC3

8) chain P
residue 170
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ASN P 906
source : DC3

9) chain P
residue 171
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ASN P 906
source : DC3

10) chain P
residue 199
type
ligand
sequence F
description BINDING SITE FOR RESIDUE ASN P 906
source : DC3

11) chain P
residue 302
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE ASN P 906
source : DC3

12) chain P
residue 351
type
ligand
sequence R
description BINDING SITE FOR RESIDUE ASN P 906
source : DC3

13) chain P
residue 418
type
ligand
sequence D
description BINDING SITE FOR RESIDUE ASN P 906
source : DC3

14) chain P
residue 72
type ACT_SITE
ligand
sequence K
description Charge relay system (By similarity).
source Swiss-Prot : SWS_FT_FI11

15) chain P
residue 147
type ACT_SITE
ligand
sequence S
description Charge relay system (By similarity).
source Swiss-Prot : SWS_FT_FI11

16) chain P
residue 171
type ACT_SITE
ligand
sequence S
description Acyl-ester intermediate (By similarity).
source Swiss-Prot : SWS_FT_FI12

17) chain P
residue 121-124
type binding
ligand ASN: ASPARAGINE
sequence AMGS
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_P_906

18) chain P
residue 146-147
type binding
ligand ASN: ASPARAGINE
sequence GS
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_P_906

19) chain P
residue 167-171
type binding
ligand ASN: ASPARAGINE
sequence DTGGS
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_P_906

20) chain P
residue 199
type binding
ligand ASN: ASPARAGINE
sequence F
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_P_906

21) chain P
residue 302-303
type binding
ligand ASN: ASPARAGINE
sequence YY
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_P_906

22) chain P
residue 351
type binding
ligand ASN: ASPARAGINE
sequence R
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_P_906

23) chain P
residue 418
type binding
ligand ASN: ASPARAGINE
sequence D
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_P_906


Display surface

Download
Links