eF-site ID 3h0l-O
PDB Code 3h0l
Chain O

click to enlarge
Title Structure of trna-dependent amidotransferase gatcab from aquifex aeolicus
Classification LIGASE
Compound Glutamyl-tRNA(Gln) amidotransferase subunit A
Source Aquifex aeolicus (GATC_AQUAE)
Sequence O:  VDREWVLKIAKLARLELKEEEIEVFQKQLSDILDFIDQLK
ELDTENVEPYIQEFEETPMREDEPHPSLDREKALMNAPER
KDGFFVVPRVV
Description (1)  Glutamyl-tRNA(Gln) amidotransferase subunit A (E.C.6.3.5.-), Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B (E.C.6.3.5.-), Glutamyl-tRNA(Gln) amidotransferase subunit C (E.C.6.3.5.-)

Display surface

Download
Links