eF-site ID 3h0l-N
PDB Code 3h0l
Chain N

click to enlarge
Title Structure of trna-dependent amidotransferase gatcab from aquifex aeolicus
Classification LIGASE
Compound Glutamyl-tRNA(Gln) amidotransferase subunit A
Source Aquifex aeolicus (GATC_AQUAE)
Sequence N:  EKYEAVIGLEIHVQMDTKTKMFCGCKVEFGAEPNTNVCPV
CLGMPGALPIVNKRAVEYAIRASLALNCEVHEESVFARKH
YFYPDLPKGYQISQYEKPLATNGWVELNLPNGEKKKVRIR
RLHIEEDAGKNIHEGDKTLVDLNRAGTPLMEIVTEPDIRT
PEEARLFLEKLRNIMRYAGVSKADMEKGQLRCDINVSIRP
KGSKEFGTRVEIKNVNSFRFVQKALEYEIERQINVVEEGG
EVVQETRTFDPQTGKTYPMRTKEEAEDYRYFPDPDLVPLK
VKKEWIEEIKKNMPELPDQRFERLIKEYGLSEYEAGILVN
HKEVGDFFEEAVRHFKEPKGIVNWLINDLLGLLRDKGISI
EESPVKPEHLAELVKLIKEKVISTKIGKEVIKEMVETGKT
PSQIVEEKGL
Description (1)  Glutamyl-tRNA(Gln) amidotransferase subunit A (E.C.6.3.5.-), Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B (E.C.6.3.5.-), Glutamyl-tRNA(Gln) amidotransferase subunit C (E.C.6.3.5.-)


Functional site

1) chain N
residue 8
type
ligand
sequence V
description BINDING SITE FOR RESIDUE ADP N 705
source : BC4

2) chain N
residue 10
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ADP N 705
source : BC4

3) chain N
residue 11
type
ligand
sequence L
description BINDING SITE FOR RESIDUE ADP N 705
source : BC4

4) chain N
residue 12
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP N 705
source : BC4

5) chain N
residue 155
type
ligand
sequence V
description BINDING SITE FOR RESIDUE ADP N 705
source : BC4

6) chain N
residue 156
type
ligand
sequence T
description BINDING SITE FOR RESIDUE ADP N 705
source : BC4

7) chain N
residue 157
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP N 705
source : BC4

8) chain N
residue 158
type
ligand
sequence P
description BINDING SITE FOR RESIDUE ADP N 705
source : BC4

9) chain N
residue 197
type
ligand
sequence N
description BINDING SITE FOR RESIDUE ADP N 705
source : BC4

10) chain N
residue 199
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ADP N 705
source : BC4

11) chain N
residue 209
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ADP N 705
source : BC4

12) chain N
residue 211
type
ligand
sequence R
description BINDING SITE FOR RESIDUE ADP N 705
source : BC4

13) chain N
residue 14
type
ligand
sequence H
description BINDING SITE FOR RESIDUE MG N 805
source : BC5

14) chain N
residue 127
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MG N 805
source : BC5

15) chain N
residue 153
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MG N 805
source : BC5

16) chain N
residue 25
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN N 905
source : BC6

17) chain N
residue 27
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN N 905
source : BC6

18) chain N
residue 40
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN N 905
source : BC6

19) chain N
residue 43
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN N 905
source : BC6

20) chain N
residue 8-12
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence VIGLE
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_N_705

21) chain N
residue 122
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_N_705

22) chain N
residue 155-158
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence VTEP
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_N_705

23) chain N
residue 197-199
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence NVS
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_N_705

24) chain N
residue 208-209
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence FG
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_N_705

25) chain N
residue 211
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_N_705


Display surface

Download
Links