eF-site ID 3h0l-M
PDB Code 3h0l
Chain M

click to enlarge
Title Structure of trna-dependent amidotransferase gatcab from aquifex aeolicus
Classification LIGASE
Compound Glutamyl-tRNA(Gln) amidotransferase subunit A
Source Aquifex aeolicus (GATC_AQUAE)
Sequence M:  MLWKKSLSELRELLKRGEVSPKEVVESFYDRYNQTEEKVK
AYITPLYGKALKQAESLKERELPLFGIPIAVKDNILVEGE
KTTCASKILENFVAPYDATVIERLKKAGALIVGKTNLDEF
AMGSSTEYSAFFPTKNPWDLERVPGGSSGGSAASVAVLSA
PVSLGSDTGGSIRQPASFCGVIGIKPTYGRVSRYGLVAFA
SSLDQIGVFGRRTEDVALVLEVISGWDEKDSTSAKVPVPE
WSEEVKKEVKGLKIGLPKEFFEYELQPQVKEAFENFIKEL
EKEGFEIKEVSLPHVKYSIPTYYIIAPSEASSNLARYDGV
RYGYRAKEYKDIFEMYARTRDEGFGPEVKRRIMLGTFALS
AGYYDAYYLKAQKVRRLITNDFLKAFEEVDVIASPTTPTL
PFKFGERLENPIEMYLSDILTVPANLAGLPAISIPIAWKD
GLPVGGQLIGKHWDETTLLQISYLWEQKFKHYEKIPLT
Description (1)  Glutamyl-tRNA(Gln) amidotransferase subunit A (E.C.6.3.5.-), Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B (E.C.6.3.5.-), Glutamyl-tRNA(Gln) amidotransferase subunit C (E.C.6.3.5.-)


Functional site

1) chain M
residue 121
type
ligand
sequence A
description BINDING SITE FOR RESIDUE ASN M 905
source : DC2

2) chain M
residue 122
type
ligand
sequence M
description BINDING SITE FOR RESIDUE ASN M 905
source : DC2

3) chain M
residue 123
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ASN M 905
source : DC2

4) chain M
residue 124
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ASN M 905
source : DC2

5) chain M
residue 169
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ASN M 905
source : DC2

6) chain M
residue 170
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ASN M 905
source : DC2

7) chain M
residue 171
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ASN M 905
source : DC2

8) chain M
residue 302
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE ASN M 905
source : DC2

9) chain M
residue 303
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE ASN M 905
source : DC2

10) chain M
residue 351
type
ligand
sequence R
description BINDING SITE FOR RESIDUE ASN M 905
source : DC2

11) chain M
residue 418
type
ligand
sequence D
description BINDING SITE FOR RESIDUE ASN M 905
source : DC2

12) chain M
residue 72
type ACT_SITE
ligand
sequence K
description Charge relay system (By similarity).
source Swiss-Prot : SWS_FT_FI9

13) chain M
residue 147
type ACT_SITE
ligand
sequence S
description Charge relay system (By similarity).
source Swiss-Prot : SWS_FT_FI9

14) chain M
residue 171
type ACT_SITE
ligand
sequence S
description Acyl-ester intermediate (By similarity).
source Swiss-Prot : SWS_FT_FI10

15) chain M
residue 121-124
type binding
ligand ASN: ASPARAGINE
sequence AMGS
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_M_905

16) chain M
residue 146-147
type binding
ligand ASN: ASPARAGINE
sequence GS
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_M_905

17) chain M
residue 167-171
type binding
ligand ASN: ASPARAGINE
sequence DTGGS
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_M_905

18) chain M
residue 199
type binding
ligand ASN: ASPARAGINE
sequence F
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_M_905

19) chain M
residue 302-303
type binding
ligand ASN: ASPARAGINE
sequence YY
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_M_905

20) chain M
residue 351
type binding
ligand ASN: ASPARAGINE
sequence R
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_M_905

21) chain M
residue 418
type binding
ligand ASN: ASPARAGINE
sequence D
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_M_905


Display surface

Download
Links