eF-site ID 3h0l-H
PDB Code 3h0l
Chain H

click to enlarge
Title Structure of trna-dependent amidotransferase gatcab from aquifex aeolicus
Classification LIGASE
Compound Glutamyl-tRNA(Gln) amidotransferase subunit A
Source Aquifex aeolicus (GATC_AQUAE)
Sequence H:  EKYEAVIGLEIHVQMDTKTKMFCGCKVEFGAEPNTNVCPV
CLGMPGALPIVNKRAVEYAIRASLALNCEVHEESVFARKH
YFYPDLPKGYQISQYEKPLATNGWVELNLPNGEKKKVRIR
RLHIEEDAGKNIHEGDKTLVDLNRAGTPLMEIVTEPDIRT
PEEARLFLEKLRNIMRYAGVSKADMEKGQLRCDINVSIRP
KGSKEFGTRVEIKNVNSFRFVQKALEYEIERQINVVEEGG
EVVQETRTFDPQTGKTYPMRTKEEAEDYRYFPDPDLVPLK
VKKEWIEEIKKNMPELPDQRFERLIKEYGLSEYEAGILVN
HKEVGDFFEEAVRHFKEPKGIVNWLINDLLGLLRDKGISI
EESPVKPEHLAELVKLIKEKVISTKIGKEVIKEMVETGKT
PSQIVEEKGL
Description (1)  Glutamyl-tRNA(Gln) amidotransferase subunit A (E.C.6.3.5.-), Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B (E.C.6.3.5.-), Glutamyl-tRNA(Gln) amidotransferase subunit C (E.C.6.3.5.-)


Functional site

1) chain H
residue 8
type
ligand
sequence V
description BINDING SITE FOR RESIDUE ADP H 703
source : AC7

2) chain H
residue 10
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ADP H 703
source : AC7

3) chain H
residue 11
type
ligand
sequence L
description BINDING SITE FOR RESIDUE ADP H 703
source : AC7

4) chain H
residue 12
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP H 703
source : AC7

5) chain H
residue 155
type
ligand
sequence V
description BINDING SITE FOR RESIDUE ADP H 703
source : AC7

6) chain H
residue 156
type
ligand
sequence T
description BINDING SITE FOR RESIDUE ADP H 703
source : AC7

7) chain H
residue 157
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP H 703
source : AC7

8) chain H
residue 158
type
ligand
sequence P
description BINDING SITE FOR RESIDUE ADP H 703
source : AC7

9) chain H
residue 197
type
ligand
sequence N
description BINDING SITE FOR RESIDUE ADP H 703
source : AC7

10) chain H
residue 199
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ADP H 703
source : AC7

11) chain H
residue 209
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ADP H 703
source : AC7

12) chain H
residue 211
type
ligand
sequence R
description BINDING SITE FOR RESIDUE ADP H 703
source : AC7

13) chain H
residue 14
type
ligand
sequence H
description BINDING SITE FOR RESIDUE MG H 803
source : AC8

14) chain H
residue 127
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MG H 803
source : AC8

15) chain H
residue 153
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MG H 803
source : AC8

16) chain H
residue 25
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN H 903
source : AC9

17) chain H
residue 27
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN H 903
source : AC9

18) chain H
residue 40
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN H 903
source : AC9

19) chain H
residue 43
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN H 903
source : AC9

20) chain H
residue 8-12
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence VIGLE
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_H_703

21) chain H
residue 122
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_H_703

22) chain H
residue 155-158
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence VTEP
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_H_703

23) chain H
residue 197-199
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence NVS
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_H_703

24) chain H
residue 208-209
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence FG
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_H_703

25) chain H
residue 211
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_H_703


Display surface

Download
Links