eF-site ID 3h0l-G
PDB Code 3h0l
Chain G

click to enlarge
Title Structure of trna-dependent amidotransferase gatcab from aquifex aeolicus
Classification LIGASE
Compound Glutamyl-tRNA(Gln) amidotransferase subunit A
Source Aquifex aeolicus (GATC_AQUAE)
Sequence G:  MLWKKSLSELRELLKRGEVSPKEVVESFYDRYNQTEEKVK
AYITPLYGKALKQAESLKERELPLFGIPIAVKDNILVEGE
KTTCASKILENFVAPYDATVIERLKKAGALIVGKTNLDEF
AMGSSTEYSAFFPTKNPWDLERVPGGSSGGSAASVAVLSA
PVSLGSDTGGSIRQPASFCGVIGIKPTYGRVSRYGLVAFA
SSLDQIGVFGRRTEDVALVLEVISGWDEKDSTSAKVPVPE
WSEEVKKEVKGLKIGLPKEFFEYELQPQVKEAFENFIKEL
EKEGFEIKEVSLPHVKYSIPTYYIIAPSEASSNLARYDGV
RYGYRAKEYKDIFEMYARTRDEGFGPEVKRRIMLGTFALS
AGYYDAYYLKAQKVRRLITNDFLKAFEEVDVIASPTTPTL
PFKFGERLENPIEMYLSDILTVPANLAGLPAISIPIAWKD
GLPVGGQLIGKHWDETTLLQISYLWEQKFKHYEKIPLT
Description (1)  Glutamyl-tRNA(Gln) amidotransferase subunit A (E.C.6.3.5.-), Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B (E.C.6.3.5.-), Glutamyl-tRNA(Gln) amidotransferase subunit C (E.C.6.3.5.-)


Functional site

1) chain G
residue 121
type
ligand
sequence A
description BINDING SITE FOR RESIDUE ASN G 903
source : CC9

2) chain G
residue 123
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ASN G 903
source : CC9

3) chain G
residue 124
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ASN G 903
source : CC9

4) chain G
residue 168
type
ligand
sequence T
description BINDING SITE FOR RESIDUE ASN G 903
source : CC9

5) chain G
residue 169
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ASN G 903
source : CC9

6) chain G
residue 170
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ASN G 903
source : CC9

7) chain G
residue 171
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ASN G 903
source : CC9

8) chain G
residue 199
type
ligand
sequence F
description BINDING SITE FOR RESIDUE ASN G 903
source : CC9

9) chain G
residue 302
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE ASN G 903
source : CC9

10) chain G
residue 351
type
ligand
sequence R
description BINDING SITE FOR RESIDUE ASN G 903
source : CC9

11) chain G
residue 418
type
ligand
sequence D
description BINDING SITE FOR RESIDUE ASN G 903
source : CC9

12) chain G
residue 72
type ACT_SITE
ligand
sequence K
description Charge relay system (By similarity).
source Swiss-Prot : SWS_FT_FI5

13) chain G
residue 147
type ACT_SITE
ligand
sequence S
description Charge relay system (By similarity).
source Swiss-Prot : SWS_FT_FI5

14) chain G
residue 171
type ACT_SITE
ligand
sequence S
description Acyl-ester intermediate (By similarity).
source Swiss-Prot : SWS_FT_FI6

15) chain G
residue 121-124
type binding
ligand ASN: ASPARAGINE
sequence AMGS
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_G_903

16) chain G
residue 146-147
type binding
ligand ASN: ASPARAGINE
sequence GS
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_G_903

17) chain G
residue 167-171
type binding
ligand ASN: ASPARAGINE
sequence DTGGS
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_G_903

18) chain G
residue 199
type binding
ligand ASN: ASPARAGINE
sequence F
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_G_903

19) chain G
residue 302-303
type binding
ligand ASN: ASPARAGINE
sequence YY
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_G_903

20) chain G
residue 351
type binding
ligand ASN: ASPARAGINE
sequence R
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_G_903

21) chain G
residue 418
type binding
ligand ASN: ASPARAGINE
sequence D
description ASPARAGINE binding site
source pdb_hetatom : ASN_3h0l_G_903


Display surface

Download
Links