eF-site ID 3h0l-E
PDB Code 3h0l
Chain E

click to enlarge
Title Structure of trna-dependent amidotransferase gatcab from aquifex aeolicus
Classification LIGASE
Compound Glutamyl-tRNA(Gln) amidotransferase subunit A
Source Aquifex aeolicus (GATC_AQUAE)
Sequence E:  EKYEAVIGLEIHVQMDTKTKMFCGCKVEFGAEPNTNVCPV
CLGMPGALPIVNKRAVEYAIRASLALNCEVHEESVFARKH
YFYPDLPKGYQISQYEKPLATNGWVELNLPNGEKKKVRIR
RLHIEEDAGKNIHEGDKTLVDLNRAGTPLMEIVTEPDIRT
PEEARLFLEKLRNIMRYAGVSKADMEKGQLRCDINVSIRP
KGSKEFGTRVEIKNVNSFRFVQKALEYEIERQINVVEEGG
EVVQETRTFDPQTGKTYPMRTKEEAEDYRYFPDPDLVPLK
VKKEWIEEIKKNMPELPDQRFERLIKEYGLSEYEAGILVN
HKEVGDFFEEAVRHFKEPKGIVNWLINDLLGLLRDKGISI
EESPVKPEHLAELVKLIKEKVISTKIGKEVIKEMVETGKT
PSQIVEEKGL
Description (1)  Glutamyl-tRNA(Gln) amidotransferase subunit A (E.C.6.3.5.-), Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B (E.C.6.3.5.-), Glutamyl-tRNA(Gln) amidotransferase subunit C (E.C.6.3.5.-)


Functional site

1) chain E
residue 8
type
ligand
sequence V
description BINDING SITE FOR RESIDUE ADP E 702
source : AC4

2) chain E
residue 10
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ADP E 702
source : AC4

3) chain E
residue 11
type
ligand
sequence L
description BINDING SITE FOR RESIDUE ADP E 702
source : AC4

4) chain E
residue 12
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP E 702
source : AC4

5) chain E
residue 155
type
ligand
sequence V
description BINDING SITE FOR RESIDUE ADP E 702
source : AC4

6) chain E
residue 156
type
ligand
sequence T
description BINDING SITE FOR RESIDUE ADP E 702
source : AC4

7) chain E
residue 157
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP E 702
source : AC4

8) chain E
residue 158
type
ligand
sequence P
description BINDING SITE FOR RESIDUE ADP E 702
source : AC4

9) chain E
residue 197
type
ligand
sequence N
description BINDING SITE FOR RESIDUE ADP E 702
source : AC4

10) chain E
residue 199
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ADP E 702
source : AC4

11) chain E
residue 209
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ADP E 702
source : AC4

12) chain E
residue 211
type
ligand
sequence R
description BINDING SITE FOR RESIDUE ADP E 702
source : AC4

13) chain E
residue 14
type
ligand
sequence H
description BINDING SITE FOR RESIDUE MG E 802
source : AC5

14) chain E
residue 127
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MG E 802
source : AC5

15) chain E
residue 153
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MG E 802
source : AC5

16) chain E
residue 25
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN E 902
source : AC6

17) chain E
residue 27
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN E 902
source : AC6

18) chain E
residue 40
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN E 902
source : AC6

19) chain E
residue 43
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN E 902
source : AC6

20) chain E
residue 8-12
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence VIGLE
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_E_702

21) chain E
residue 122-123
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence RR
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_E_702

22) chain E
residue 155-158
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence VTEP
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_E_702

23) chain E
residue 197-199
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence NVS
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_E_702

24) chain E
residue 208-209
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence FG
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_E_702

25) chain E
residue 211
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_E_702


Display surface

Download
Links