eF-site ID 3h0l-B
PDB Code 3h0l
Chain B

click to enlarge
Title Structure of trna-dependent amidotransferase gatcab from aquifex aeolicus
Classification LIGASE
Compound Glutamyl-tRNA(Gln) amidotransferase subunit A
Source Aquifex aeolicus (GATC_AQUAE)
Sequence B:  EKYEAVIGLEIHVQMDTKTKMFCGCKVEFGAEPNTNVCPV
CLGMPGALPIVNKRAVEYAIRASLALNCEVHEESVFARKH
YFYPDLPKGYQISQYEKPLATNGWVELNLPNGEKKKVRIR
RLHIEEDAGKNIHEGDKTLVDLNRAGTPLMEIVTEPDIRT
PEEARLFLEKLRNIMRYAGVSKADMEKGQLRCDINVSIRP
KGSKEFGTRVEIKNVNSFRFVQKALEYEIERQINVVEEGG
EVVQETRTFDPQTGKTYPMRTKEEAEDYRYFPDPDLVPLK
VKKEWIEEIKKNMPELPDQRFERLIKEYGLSEYEAGILVN
HKEVGDFFEEAVRHFKEPKGIVNWLINDLLGLLRDKGISI
EESPVKPEHLAELVKLIKEKVISTKIGKEVIKEMVETGKT
PSQIVEEKGL
Description (1)  Glutamyl-tRNA(Gln) amidotransferase subunit A (E.C.6.3.5.-), Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B (E.C.6.3.5.-), Glutamyl-tRNA(Gln) amidotransferase subunit C (E.C.6.3.5.-)


Functional site

1) chain B
residue 8
type
ligand
sequence V
description BINDING SITE FOR RESIDUE ADP B 701
source : AC1

2) chain B
residue 10
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ADP B 701
source : AC1

3) chain B
residue 11
type
ligand
sequence L
description BINDING SITE FOR RESIDUE ADP B 701
source : AC1

4) chain B
residue 12
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP B 701
source : AC1

5) chain B
residue 155
type
ligand
sequence V
description BINDING SITE FOR RESIDUE ADP B 701
source : AC1

6) chain B
residue 156
type
ligand
sequence T
description BINDING SITE FOR RESIDUE ADP B 701
source : AC1

7) chain B
residue 157
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP B 701
source : AC1

8) chain B
residue 158
type
ligand
sequence P
description BINDING SITE FOR RESIDUE ADP B 701
source : AC1

9) chain B
residue 197
type
ligand
sequence N
description BINDING SITE FOR RESIDUE ADP B 701
source : AC1

10) chain B
residue 199
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ADP B 701
source : AC1

11) chain B
residue 209
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ADP B 701
source : AC1

12) chain B
residue 211
type
ligand
sequence R
description BINDING SITE FOR RESIDUE ADP B 701
source : AC1

13) chain B
residue 14
type
ligand
sequence H
description BINDING SITE FOR RESIDUE MG B 801
source : AC2

14) chain B
residue 127
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MG B 801
source : AC2

15) chain B
residue 153
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MG B 801
source : AC2

16) chain B
residue 25
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN B 901
source : AC3

17) chain B
residue 27
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN B 901
source : AC3

18) chain B
residue 40
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN B 901
source : AC3

19) chain B
residue 43
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN B 901
source : AC3

20) chain B
residue 8-12
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence VIGLE
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_B_701

21) chain B
residue 122
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_B_701

22) chain B
residue 155-158
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence VTEP
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_B_701

23) chain B
residue 197-199
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence NVS
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_B_701

24) chain B
residue 208-209
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence FG
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_B_701

25) chain B
residue 211
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_3h0l_B_701


Display surface

Download
Links